pKGWFS7.1

$260.00

  • Model: PVT11157
  • 50 Units in Stock
Ask a question


Add to Cart:

pKGWFS7.1


Catalog No. PVT11157
Packing 2ug

 

pKGWFS7.1  Information
Function plant expression plasmid
Resistance Spe
Screen Neo/G418
Strain DB3.1
Culture temperature 37degrees centigrade
Replicon pBR322
Copy Middle
Promoter
Induction
Forward primer
Reverse primer

 

pKGWFS7.1 Description

PKGWFS7.1 is plant protein expressing GateWay plasmid.

 

pKGWFS7.1 Sequence

LOCUS       Exported               12986 bp ds-DNA     circular SYN 22-JAN-2018

FEATURES             Location/Qualifiers

     source          1..12986

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    75..99

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     terminator      192..444

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             complement(484..1278)

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=Neo

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     promoter        complement(1312..1491)

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

     protein_bind    1630..1754

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        1779..1809

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             1863..2522

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=CmR

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             2864..3169

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(3210..3334)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             3345..4058

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELY"

     CDS             4068..5879

                     /codon_start=1

                     /gene="uidA (or gusA) from E. coli"

                     /product="beta-glucuronidase"

                     /label=GUS

                     /translation="MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI

                     AVPGSFNDQFADADFRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEV

                     MEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHD

                     FFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQ

                     VVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQF

                     LINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDW

                     ADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARD

                     KNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISD

                     LFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMY

                     TDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRK

                     PKSAAFLLQKRWTGMNFGEKPQQGGKQ"

     misc_feature    6205..6229

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             7560..8189

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     rep_origin      9759..9953

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    10297..10438

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(10624..11212)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(11458..12249)

                     /codon_start=1

                     /gene="aadA"

                     /product="aminoglycoside adenylyltransferase (Murphy, 

                     1985)"

                     /label=SmR

                     /note="confers resistance to spectinomycin and 

                     streptomycin"

                     /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH

                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK

                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF

                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP

                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"

ORIGIN

        1 tcggatgatg ggctgcctgt atcgagtggt gattttgtgc cgagctgccg gtcggggagc

       61 tgttggctgg ctggtggcag gatatattgt ggtgtaaaca aattgacgct tagacaactt

      121 aataacacat tgcggacgtt tttaatgtac tgaattaacg ccgaattgaa ttatcagctt

      181 gcatgccggt cgatctagta acatagatga caccgcgcgc gataatttat cctagtttgc

      241 gcgctatatt ttgttttcta tcgcgtatta aatgtataat tgcgggactc taatcataaa

      301 aacccatctc ataaataacg tcatgcatta catgttaatt attacatgct taacgtaatt

      361 caacagaaat tatatgataa tcatcgcaag accggcaaca ggattcaatc ttaagaaact

      421 ttattgccaa atgtttgaac gatctgcttg actctagcta gagtccgaac cccagagtcc

      481 cgctcagaag aactcgtcaa gaaggcgata gaaggcgatg cgctgcgaat cgggagcggc

      541 gataccgtaa agcacgagga agcggtcagc ccattcgccg ccaagctctt cagcaatatc

      601 acgggtagcc aacgctatgt cctgatagcg gtccgccaca cccagccggc cacagtcgat

      661 gaatccagaa aagcggccat tttccaccat gatattcggc aagcaggcat cgccgtgggt

      721 cacgacgaga tcctcgccgt cgggcatccg cgccttgagc ctggcgaaca gttcggctgg

      781 cgcgagcccc tgatgctctt cgtccagatc atcctgatcg acaagaccgg cttccatccg

      841 agtacgtgct cgctcgatgc gatgtttcgc ttggtggtcg aatgggcagg tagccggatc

      901 aagcgtatgc agccgccgca ttgcatcagc catgatggat actttctcgg caggagcaag

      961 gtgagatgac aggagatcct gccccggcac ttcgcccaat agcagccagt cccttcccgc

     1021 ttcagtgaca acgtcgagca cagctgcgca aggaacgccc gtcgtggcca gccacgatag

     1081 ccgcgctgcc tcgtcttgga gttcattcag ggcaccggac aggtcggtct tgacaaaaag

     1141 aaccgggcgc ccctgcgctg acagccggaa cacggcggca tcagagcagc cgattgtctg

     1201 ttgtgcccag tcatagccga atagcctctc cacccaagcg gccggagaac ctgcgtgcaa

     1261 tccatcttgt tcaatcatgc ctcgatcgag ttgagagtga atatgagact ctaattggat

     1321 accgagggga atttatggaa cgtcagtgga gcatttttga caagaaatat ttgctagctg

     1381 atagtgacct taggcgactt ttgaacgcgc aataatggtt tctgacgtat gtgcttagct

     1441 cattaaactc cagaaacccg cggctcagtg gctccttcaa cgttgcggtt ctgtcagttc

     1501 caaacgtaaa acggcttgtc ccgcgtcatc ggcgggggtc ataacgtgac tcccttaatt

     1561 ctccgctcat gatcgataat tcgagctctc ccatatggtc gacctgcagg cggccgcact

     1621 agtgatatca caagtttgta caaaaaagct gaacgagaaa cgtaaaatga tataaatatc

     1681 aatatattaa attagatttt gcataaaaaa cagactacat aatactgtaa aacacaacat

     1741 atccagtcac tatggcggcc gcattaggca ccccaggctt tacactttat gcttccggct

     1801 cgtataatgt gtggattttg agttaggatc cgtcgagatt ttcaggagct aaggaagcta

     1861 aaatggagaa aaaaatcact ggatatacca ccgttgatat atcccaatgg catcgtaaag

     1921 aacattttga ggcatttcag tcagttgctc aatgtaccta taaccagacc gttcagctgg

     1981 atattacggc ctttttaaag accgtaaaga aaaataagca caagttttat ccggccttta

     2041 ttcacattct tgcccgcctg atgaatgctc atccggaatt ccgtatggca atgaaagacg

     2101 gtgagctggt gatatgggat agtgttcacc cttgttacac cgttttccat gagcaaactg

     2161 aaacgttttc atcgctctgg agtgaatacc acgacgattt ccggcagttt ctacacatat

     2221 attcgcaaga tgtggcgtgt tacggtgaaa acctggccta tttccctaaa gggtttattg

     2281 agaatatgtt tttcgtctca gccaatccct gggtgagttt caccagtttt gatttaaacg

     2341 tggccaatat ggacaacttc ttcgcccccg ttttcaccat gggcaaatat tatacgcaag

     2401 gcgacaaggt gctgatgccg ctggcgattc aggttcatca tgccgtttgt gatggcttcc

     2461 atgtcggcag aatgcttaat gaattacaac agtactgcga tgagtggcag ggcggggcgt

     2521 aaacgcgtgg atccggctta ctaaaagcca gataacagta tgcgtatttg cgcgctgatt

     2581 tttgcggtat aagaatatat actgatatgt atacccgaag tatgtcaaaa agaggtatgc

     2641 tatgaagcag cgtattacag tgacagttga cagcgacagc tatcagttgc tcaaggcata

     2701 tatgatgtca atatctccgg tctggtaagc acaaccatgc agaatgaagc ccgtcgtctg

     2761 cgtgccgaac gctggaaagc ggaaaatcag gaagggatgg ctgaggtcgc ccggtttatt

     2821 gaaatgaacg gctcttttgc tgacgagaac aggggctggt gaaatgcagt ttaaggttta

     2881 cacctataaa agagagagcc gttatcgtct gtttgtggat gtacagagtg atattattga

     2941 cacgcccggg cgacggatgg tgatccccct ggccagtgca cgtctgctgt cagataaagt

     3001 ctcccgtgaa ctttacccgg tggtgcatat cggggatgaa agctggcgca tgatgaccac

     3061 cgatatggcc agtgtgccgg tctccgttat cggggaagaa gtggctgatc tcagccaccg

     3121 cgaaaatgac atcaaaaacg ccattaacct gatgttctgg ggaatataaa tgtcaggctc

     3181 ccttatacac agccagtctg caggtcgacc atagtgactg gatatgttgt gttttacagt

     3241 attatgtagt ctgtttttta tgcaaaatct aatttaatat attgatattt atatcatttt

     3301 acgtttctcg ttcagctttc ttgtacaaag tggtgatatc ccggatggtg agcaagggcg

     3361 aggagctgtt caccggggtg gtgcccatcc tggtcgagct ggacggcgac gtaaacggcc

     3421 acaagttcag cgtgtccggc gagggcgagg gcgatgccac ctacggcaag ctgaccctga

     3481 agttcatctg caccaccggc aagctgcccg tgccctggcc caccctcgtg accaccctga

     3541 cctacggcgt gcagtgcttc agccgctacc ccgaccacat gaagcagcac gacttcttca

     3601 agtccgccat gcccgaaggc tacgtccagg agcgcaccat cttcttcaag gacgacggca

     3661 actacaagac ccgcgccgag gtgaagttcg agggcgacac cctggtgaac cgcatcgagc

     3721 tgaagggcat cgacttcaag gaggacggca acatcctggg gcacaagctg gagtacaact

     3781 acaacagcca caacgtctat atcatggccg acaagcagaa gaacggcatc aaggtgaact

     3841 tcaagatccg ccacaacatc gaggacggca gcgtgcagct cgccgaccac taccagcaga

     3901 acacccccat cggcgacggc cccgtgctgc tgcccgacaa ccactacctg agcacccagt

     3961 ccgccctgag caaagacccc aacgagaagc gcgatcacat ggtcctgctg gagttcgtga

     4021 ccgccgccgg gatcactctc ggcatggacg agctgtacga acccggcatg ttacgtcctg

     4081 tagaaacccc aacccgtgaa atcaaaaaac tcgacggcct gtgggcattc agtctggatc

     4141 gcgaaaactg tggaattgat cagcgttggt gggaaagcgc gttacaagaa agccgggcaa

     4201 ttgctgtgcc aggcagtttt aacgatcagt tcgccgatgc agattttcgt aattatgcgg

     4261 gcaacgtctg gtatcagcgc gaagtcttta taccgaaagg ttgggcaggc cagcgtatcg

     4321 tgctgcgttt cgatgcggtc actcattacg gcaaagtgtg ggtcaataat caggaagtga

     4381 tggagcatca gggcggctat acgccatttg aagccgatgt cacgccgtat gttattgccg

     4441 ggaaaagtgt acgtatcacc gtttgcgtga acaacgaact gaactggcag actatcccgc

     4501 cgggaatggt gattaccgac gaaaacggca agaaaaagca gtcttacttc catgatttct

     4561 ttaactatgc cggaatccat cgcagcgtaa tgctctacac cacgccgaac acctgggtgg

     4621 acgatatcac cgtggtgacg catgtcgcgc aagactgtaa ccacgcgtct gttgactggc

     4681 aggtggtggc caatggtgat gtcagcgttg aactgcgtga tgcggatcaa caggtggttg

     4741 caactggaca aggcactagc gggactttgc aagtggtgaa tccgcacctc tggcaaccgg

     4801 gtgaaggtta tctctatgaa ctgtgcgtca cagccaaaag ccagacagag tgtgatatct

     4861 acccgcttcg cgtcggcatc cggtcagtgg cagtgaaggg cgaacagttc ctgattaacc

     4921 acaaaccgtt ctactttact ggctttggtc gtcatgaaga tgcggacttg cgtggcaaag

     4981 gattcgataa cgtgctgatg gtgcacgacc acgcattaat ggactggatt ggggccaact

     5041 cctaccgtac ctcgcattac ccttacgctg aagagatgct cgactgggca gatgaacatg

     5101 gcatcgtggt gattgatgaa actgctgctg tcggctttaa cctctcttta ggcattggtt

     5161 tcgaagcggg caacaagccg aaagaactgt acagcgaaga ggcagtcaac ggggaaactc

     5221 agcaagcgca cttacaggcg attaaagagc tgatagcgcg tgacaaaaac cacccaagcg

     5281 tggtgatgtg gagtattgcc aacgaaccgg atacccgtcc gcaaggtgca cgggaatatt

     5341 tcgcgccact ggcggaagca acgcgtaaac tcgacccgac gcgtccgatc acctgcgtca

     5401 atgtaatgtt ctgcgacgct cacaccgata ccatcagcga tctctttgat gtgctgtgcc

     5461 tgaaccgtta ttacggatgg tatgtccaaa gcggcgattt ggaaacggca gagaaggtac

     5521 tggaaaaaga acttctggcc tggcaggaga aactgcatca gccgattatc atcaccgaat

     5581 acggcgtgga tacgttagcc gggctgcact caatgtacac cgacatgtgg agtgaagagt

     5641 atcagtgtgc atggctggat atgtatcacc gcgtctttga tcgcgtcagc gccgtcgtcg

     5701 gtgaacaggt atggaatttc gccgattttg cgacctcgca aggcatattg cgcgttggcg

     5761 gtaacaagaa agggatcttc actcgcgacc gcaaaccgaa gtcggcggct tttctgctgc

     5821 aaaaacgctg gactggcatg aacttcggtg aaaaaccgca gcagggaggc aaacaatgac

     5881 catggcggcc gggagggcca tgctagagtc cgcaaaaatc accagtctct ctctacaaat

     5941 ctatctctct ctatttttct ccagaataat gtgtgagtag ttcccagata agggaattag

     6001 ggttcttata gggtttcgct catgtgttga gcatataaga aacccttagt atgtatttgt

     6061 atttgtaaaa tacttctatc aataaaattt ctaattccta aaaccaaaat ccagtgacct

     6121 gcaggcatgc gacgtcgggc ccaagcttag cttgagcttg gatcagattg tcgtttcccg

     6181 ccttcagttt aaactatcag tgtttgacag gatatattgg cgggtaaacc taagagaaaa

     6241 gagcgtttat tagaataatc ggatatttaa aagggcgtga aaaggtttat ccgttcgtcc

     6301 atttgtatgt gcatgccaac cacagggttc ccctcgggat caaagtactt taaagtactt

     6361 taaagtactt taaagtactt tgatccaacc cctccgctgc tatagtgcag tcggcttctg

     6421 acgttcagtg cagccgtctt ctgaaaacga catgtcgcac aagtcctaag ttacgcgaca

     6481 ggctgccgcc ctgccctttt cctggcgttt tcttgtcgcg tgttttagtc gcataaagta

     6541 gaatacttgc gactagaacc ggagacatta cgccatgaac aagagcgccg ccgctggcct

     6601 gctgggctat gcccgcgtca gcaccgacga ccaggacttg accaaccaac gggccgaact

     6661 gcacgcggcc ggctgcacca agctgttttc cgagaagatc accggcacca ggcgcgaccg

     6721 cccggagctg gccaggatgc ttgaccacct acgccctggc gacgttgtga cagtgaccag

     6781 gctagaccgc ctggcccgca gcacccgcga cctactggac attgccgagc gcatccagga

     6841 ggccggcgcg ggcctgcgta gcctggcaga gccgtgggcc gacaccacca cgccggccgg

     6901 ccgcatggtg ttgaccgtgt tcgccggcat tgccgagttc gagcgttccc taatcatcga

     6961 ccgcacccgg agcgggcgcg aggccgccaa ggcccgaggc gtgaagtttg gcccccgccc

     7021 taccctcacc ccggcacaga tcgcgcacgc ccgcgagctg atcgaccagg aaggccgcac

     7081 cgtgaaagag gcggctgcac tgcttggcgt gcatcgctcg accctgtacc gcgcacttga

     7141 gcgcagcgag gaagtgacgc ccaccgaggc caggcggcgc ggtgccttcc gtgaggacgc

     7201 attgaccgag gccgacgccc tggcggccgc cgagaatgaa cgccaagagg aacaagcatg

     7261 aaaccgcacc aggacggcca ggacgaaccg tttttcatta ccgaagagat cgaggcggag

     7321 atgatcgcgg ccgggtacgt gttcgagccg cccgcgcacg tctcaaccgt gcggctgcat

     7381 gaaatcctgg ccggtttgtc tgatgccaag ctggcggcct ggccggccag cttggccgct

     7441 gaagaaaccg agcgccgccg tctaaaaagg tgatgtgtat ttgagtaaaa cagcttgcgt

     7501 catgcggtcg ctgcgtatat gatgcgatga gtaaataaac aaatacgcaa ggggaacgca

     7561 tgaaggttat cgctgtactt aaccagaaag gcgggtcagg caagacgacc atcgcaaccc

     7621 atctagcccg cgccctgcaa ctcgccgggg ccgatgttct gttagtcgat tccgatcccc

     7681 agggcagtgc ccgcgattgg gcggccgtgc gggaagatca accgctaacc gttgtcggca

     7741 tcgaccgccc gacgattgac cgcgacgtga aggccatcgg ccggcgcgac ttcgtagtga

     7801 tcgacggagc gccccaggcg gcggacttgg ctgtgtccgc gatcaaggca gccgacttcg

     7861 tgctgattcc ggtgcagcca agcccttacg acatatgggc caccgccgac ctggtggagc

     7921 tggttaagca gcgcattgag gtcacggatg gaaggctaca agcggccttt gtcgtgtcgc

     7981 gggcgatcaa aggcacgcgc atcggcggtg aggttgccga ggcgctggcc gggtacgagc

     8041 tgcccattct tgagtcccgt atcacgcagc gcgtgagcta cccaggcact gccgccgccg

     8101 gcacaaccgt tcttgaatca gaacccgagg gcgacgctgc ccgcgaggtc caggcgctgg

     8161 ccgctgaaat taaatcaaaa ctcatttgag ttaatgaggt aaagagaaaa tgagcaaaag

     8221 cacaaacacg ctaagtgccg gccgtccgag cgcacgcagc agcaaggctg caacgttggc

     8281 cagcctggca gacacgccag ccatgaagcg ggtcaacttt cagttgccgg cggaggatca

     8341 caccaagctg aagatgtacg cggtacgcca aggcaagacc attaccgagc tgctatctga

     8401 atacatcgcg cagctaccag agtaaatgag caaatgaata aatgagtaga tgaattttag

     8461 cggctaaagg aggcggcatg gaaaatcaag aacaaccagg caccgacgcc gtggaatgcc

     8521 ccatgtgtgg aggaacgggc ggttggccag gcgtaagcgg ctgggttgtc tgccggccct

     8581 gcaatggcac tggaaccccc aagcccgagg aatcggcgtg agcggtcgca aaccatccgg

     8641 cccggtacaa atcggcgcgg cgctgggtga tgacctggtg gagaagttga aggccgcgca

     8701 ggccgcccag cggcaacgca tcgaggcaga agcacgcccc ggtgaatcgt ggcaagcggc

     8761 cgctgatcga atccgcaaag aatcccggca accgccggca gccggtgcgc cgtcgattag

     8821 gaagccgccc aagggcgacg agcaaccaga ttttttcgtt ccgatgctct atgacgtggg

     8881 cacccgcgat agtcgcagca tcatggacgt ggccgttttc cgtctgtcga agcgtgaccg

     8941 acgagctggc gaggtgatcc gctacgagct tccagacggg cacgtagagg tttccgcagg

     9001 gccggccggc atggccagtg tgtgggatta cgacctggta ctgatggcgg tttcccatct

     9061 aaccgaatcc atgaaccgat accgggaagg gaagggagac aagcccggcc gcgtgttccg

     9121 tccacacgtt gcggacgtac tcaagttctg ccggcgagcc gatggcggaa agcagaaaga

     9181 cgacctggta gaaacctgca ttcggttaaa caccacgcac gttgccatgc agcgtacgaa

     9241 gaaggccaag aacggccgcc tggtgacggt atccgagggt gaagccttga ttagccgcta

     9301 caagatcgta aagagcgaaa ccgggcggcc ggagtacatc gagatcgagc tagctgattg

     9361 gatgtaccgc gagatcacag aaggcaagaa cccggacgtg ctgacggttc accccgatta

     9421 ctttttgatc gatcccggca tcggccgttt tctctaccgc gcctggcacg ccgcgccgca

     9481 ggcaaggcag aagccagatg gttgttcaag acgatctacg aacgcagtgg cagcgccgga

     9541 gagttcaaga agttctgttt caccgtgcgc aagctgatcg ggtcaaatga cctgccggag

     9601 tacgatttga aggaggaggc ggggcaggct ggcccgatcc tagtcatgcg ctaccgcaac

     9661 ctgatcgagg gcgaagcatc cgccggttcc taatgtacgg agcagatgct agggcaaatt

     9721 gccctagcag gggaaaaagg tcgaaaaggt ctctttcctg tggatagcac gtacattggg

     9781 aacccaaagc cgtacattgg gaaccggaac ccgtacattg ggaacccaaa gccgtacatt

     9841 gggaaccggt cacacatgta agtgactgat ataaaagaga aaaaaggcga tttttccgcc

     9901 taaaactctt taaaacttat taaaactctt aaaacccgcc tggcctgtgc ataactgtct

     9961 ggccagcgca cagccgaaga gctgcaaaaa gcgcctaccc ttcggtcgct gcgctcccta

    10021 cgccccgccg cttcgcgtcg gcctatcgcg gccgctggcc gctcaaaaat ggctggccta

    10081 cggccaggca atctaccagg gcgcggacaa gccgcgccgt cgccactcga ccgccggcgc

    10141 ccacatcaag gcaccctgcc tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat

    10201 gcagctcccg gagacggtca cagcttgtct gtaagcggat gccgggagca gacaagcccg

    10261 tcagggcgcg tcagcgggtg ttggcgggtg tcggggcgca gccatgaccc agtcacgtag

    10321 cgatagcgga gtgtatactg gcttaactat gcggcatcag agcagattgt actgagagtg

    10381 caccatatgc ggtgtgaaat accgcacaga tgcgtaagga gaaaaatacc gcatcaggcg

    10441 ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc ggcgagcggt

    10501 atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata acgcaggaaa

    10561 gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg cgttgctggc

    10621 gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct caagtcagag

    10681 gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa gctccctcgt

    10741 gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc tcccttcggg

    10801 aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt aggtcgttcg

    10861 ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg ccttatccgg

    10921 taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg cagcagccac

    10981 tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct tgaagtggtg

    11041 gcctaactac ggctacacta gaaggacagt atttggtatc tgcgctctgc tgaagccagt

    11101 taccttcgga aaaagagttg gtagctcttg atccggcaaa caaaccaccg ctggtagcgg

    11161 tggttttttt gtttgcaagc agcagattac gcgcagaaaa aaaggatctc aagaagatcc

    11221 tttgatcttt tctacggggt ctgacgctca gtggaacgaa aactcacgtt aagggatttt

    11281 ggtcatgcat gatatatctc ccaatttgtg tagggcttat tatgcacgct taaaaataat

    11341 aaaagcagac ttgacctgat agtttggctg tgagcaatta tgtgcttagt gcatctaacg

    11401 cttgagttaa gccgcgccgc gaagcggcgt cggcttgaac gaatttctag ctagacatta

    11461 tttgccgact accttggtga tctcgccttt cacgtagtgg acaaattctt ccaactgatc

    11521 tgcgcgcgag gccaagcgat cttcttcttg tccaagataa gcctgtctag cttcaagtat

    11581 gacgggctga tactgggccg gcaggcgctc cattgcccag tcggcagcga catccttcgg

    11641 cgcgattttg ccggttactg cgctgtacca aatgcgggac aacgtaagca ctacatttcg

    11701 ctcatcgcca gcccagtcgg gcggcgagtt ccatagcgtt aaggtttcat ttagcgcctc

    11761 aaatagatcc tgttcaggaa ccggatcaaa gagttcctcc gccgctggac ctaccaaggc

    11821 aacgctatgt tctcttgctt ttgtcagcaa gatagccaga tcaatgtcga tcgtggctgg

    11881 ctcgaagata cctgcaagaa tgtcattgcg ctgccattct ccaaattgca gttcgcgctt

    11941 agctggataa cgccacggaa tgatgtcgtc gtgcacaaca atggtgactt ctacagcgcg

    12001 gagaatctcg ctctctccag gggaagccga agtttccaaa aggtcgttga tcaaagctcg

    12061 ccgcgttgtt tcatcaagcc ttacggtcac cgtaaccagc aaatcaatat cactgtgtgg

    12121 cttcaggccg ccatccactg cggagccgta caaatgtacg gccagcaacg tcggttcgag

    12181 atggcgctcg atgacgccaa ctacctctga tagttgagtc gatacttcgg cgatcaccgc

    12241 ttcccccatg atgtttaact ttgttttagg gcgactgccc tgctgcgtaa catcgttgct

    12301 gctccataac atcaaacatc gacccacggc gtaacgcgct tgctgcttgg atgcccgagg

    12361 catagactgt accccaaaaa aacagtcata acaagccatg aaaaccgcca ctgcgccgtt

    12421 accaccgctg cgttcggtca aggttctgga ccagttgcgt gagcgcatac gctacttgca

    12481 ttacagctta cgaaccgaac aggcttatgt ccactgggtt cgtgcccgaa ttgatcacag

    12541 gcagcaacgc tctgtcatcg ttacaatcaa catgctaccc tccgcgagat catccgtgtt

    12601 tcaaacccgg cagcttagtt gccgttcttc cgaatagcat cggtaacatg agcaaagtct

    12661 gccgccttac aacggctctc ccgctgacgc cgtcccggac tgatgggctg cctgtatcga

    12721 gtggcgattt tgtgccgagc tgccggtcgg ggagctgttg gctggctggt ggcaggatat

    12781 attgtggata aacaaattga cgcttaaaaa acttaataac acattgcgga tgttttaatg

    12841 aactgaatta cccccaaatt gaattttaaa cttgcatgcc ggtcgatctt ataaaatata

    12901 tgacacagcg cgagataatt tatcttagat tgaccgctcc atttgtttgc tatcatatat

    12961 cctttgcata ttcgcctgaa atctct

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart