pKJE7 Plasmid

$216.00

  • Model: PVT0804
  • 50 Units in Stock
Ask a question


Add to Cart:

pKJE7

Search name

pKJE7,Plasmid pKJE7,pKJE7 vector

 

pKJE7 Plasmid Information

Replicon: p15A ori

Plasmid classification: Escherichia coli vector; chaperone expression plasmid

Plasmid size: 7.2kb

Prokaryotic resistance: chloramphenicol Chl

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

Inducement: Arabia sugar

Remarks: plasmids of chaperone

 

pKJE7 Plasmid Sequence

LOCUS       Exported                7193 bp ds-DNA     circular SYN 12-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 14
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7193)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Monday, September 12, 2016 from SnapGene Viewer 3.1.4
            
FEATURES             Location/Qualifiers
     source          1..7193
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      5802..6346
                     /direction=RIGHT
                     /note="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     promoter        6872..6974
                     /note="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             6975..441
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
ORIGIN
        1 cgtatggcaa tgaaagacgg tgagctggtg atatgggata gtgttcaccc ttgttacacc
       61 gttttccatg agcaaactga aacgttttca tcgctctgga gtgaatacca cgacgatttc
      121 cggcagtttc tacacatata ttcgcaagat gtggcgtgtt acggtgaaaa cctggcctat
      181 ttccctaaag ggtttattga gaatatgttt ttcgtctcag ccaatccctg ggtgagtttc
      241 accagttttg atttaaacgt ggccaatatg gacaacttct tcgcccccgt tttcaccatg
      301 ggcaaatatt atacgcaagg cgacaaggtg ctgatgccgc tggcgattca ggttcatcat
      361 gccgtctgtg atggcttcca tgtcggcaga atgcttaatg aattacaaca gtactgcgat
      421 gagtggcagg gcggggcgta atttttttaa ggcagttatt ggtgccctta aacgcctggt
      481 gctacgcctg aataagtgat aataagcgga tgaatggcag aaattcgaag aatagttacg
      541 gcttatgaca tctttgtgga cacatcattc actttttatt cacatccggc cctgaactcg
      601 ctaggacttg ccccggtgca ttttttaaat acccgcgaaa aatagagctg atcgtcaaat
      661 ccaacattgc gcccaacggt cgctatcggc attcgcgtag tgctaagcag aagtttcgcc
      721 tggctgatac gctgatcttc gcgccagctc aatacgctaa tgcctaactg ctggcggaac
      781 agatgtgata accgggaggg cgacaggcag acatgctggg cgacgctggc gatatcaaaa
      841 tggctgtccg ccagatggtc gctgatatac tggcaggcat cgcgcacacg gctatccatc
      901 ggcgggtgca acgactcatt aattaccgcc atacgtctga gcaacaactg ctccagcaga
      961 ttgatcgcca gtagctcaga atagcgacct tccccttgcc cggcgctgat gatctgcccg
     1021 aacagttcgc tgaaatgcgg ctggcgcgcc tcgtccgggc ggaaaaatcc tgtctgggca
     1081 aagattgtcg gccaggtcag ccactcctgc cagtaggcgc gaggccggaa ataaacccac
     1141 tggtgatacc actcgctggc gtccggatgc cgtccatagt gatgaatctc gcccggcgga
     1201 aacaataata tatcgccagg ccgacagaca aactgctcgc cattattatt aatgacgccc
     1261 tctccgcgga tggtcaggtt aagaatatat cccttcatgc ccaacggacg atcgataaaa
     1321 aaatccagat atccattcgc ttcaattggc gtcagcccgg cgaccagatg ggcattaaat
     1381 gaatatcccg gcaatagcgg atcattttgc gtttcagcca tgatttctct accccccgat
     1441 gttcagagaa gaaccaaatt gtccatatcg accaggacga cagagcttcc gtctccgcaa
     1501 gactttgcgc ttgatgaaag cacgtatcaa ccccgcttgt gaaaagcgct ttgtaacaaa
     1561 agcgtacagt tcaggcgata aaattaagta acagaagtgt ctataactat ggctggaatg
     1621 tccacattga atatttgcac agcgtcacac tttgcaaagc attagcattt ttgtccataa
     1681 gattagcgga tcctgcctga cggtttttgc cgcgactctc tataatttct ccatacctgt
     1741 ttttctggat ggagtaagac catggctatg gattgtggag acgtttagat gggtaaaata
     1801 attggtatcg acctgggtac taccaactct tgtgtagcga ttatggatgg caccactcct
     1861 cgcgtgctgg agaacgccga aggcgatcgc accacgcctt ctatcattgc ctatacccag
     1921 gatggtgaaa ctctagttgg tcagccggct aaacgtcagg cagtgacgaa cccgcaaaac
     1981 actctgtttg cgattaaacg cctgattggt cgccgcttcc aggacgaaga agtacagcgt
     2041 gatgtttcca tcatgccgtt caaaattatt gctgctgata acggcgacgc atgggtcgaa
     2101 gttaaaggcc agaaaatggc accgccgcag atttctgctg aagtgctgaa aaaaatgaag
     2161 aaaaccgctg aagattacct gggtgaaccg gtaactgaag ctgttatcac cgtaccggca
     2221 tactttaacg atgctcagcg tcaggcaacc aaagacgcag gccgtatcgc tggtctggaa
     2281 gtaaaacgta tcatcaacga accgaccgca gctgcgctgg cttacggtct ggacaaaggc
     2341 actggcaacc gtactatcgc ggtttatgac ctgggtggtg gtactttcga tatttctatt
     2401 atcgaaatcg acgaagttga cggcgaaaaa accttcgaag ttctggcaac caacggtgat
     2461 acccacctgg ggggtgaaga cttcgacagc cgtctgatca actatctggt tgaagaattc
     2521 aagaaagatc agggcattga cctgcgcaac gatccgctgg caatgcagcg cctgaaagaa
     2581 gcggcagaaa aagcgaaaat cgaactgtct tccgctcagc agaccgacgt taacctgcca
     2641 tacatcactg cagacgcgac cggtccgaaa cacatgaaca tcaaagtgac tcgtgcgaaa
     2701 ctggaaagcc tggttgaaga tctggtaaac cgttccattg agccgctgaa agttgcactg
     2761 caggacgctg gcctgtccgt atctgatatc gacgacgtta tcctcgttgg tggtcagact
     2821 cgtatgccaa tggttcagaa gaaagttgct gagttctttg gtaaagagcc gcgtaaagac
     2881 gttaacccgg acgaagctgt agcaatcggt gctgctgttc agggtggtgt tctgactggt
     2941 gacgtaaaag acgtactgct gctggacgtt accccgctgt ctctgggtat cgaaaccatg
     3001 ggcggtgtga tgacgacgct gatcgcgaaa aacaccacta tcccgaccaa gcacagccag
     3061 gtgttctcta ccgctgaaga caaccagtct gcggtaacca tccatgtgct gcagggtgaa
     3121 cgtaaacgtg cggctgataa caaatctctg ggtcagttca acctagatgg tatcaacccg
     3181 gcaccgcgcg gcatgccgca gatcgaagtt accttcgata tcgatgctga cggtatcctg
     3241 cacgtttccg cgaaagataa aaacagcggt aaagagcaga agatcaccat caaggcttct
     3301 tctggtctga acgaagatga aatccagaaa atggtacgcg acgcagaagc taacgccgaa
     3361 gctgaccgta agtttgaaga gctggtacag actcgcaacc agggcgacca tctgctgcac
     3421 agcacccgta agcaggttga agaagcaggc gacaaactgc cggctgacga caaaactgct
     3481 atcgagtctg cgctgactgc actggaaact gctctgaaag gtgaagacaa agccgctatc
     3541 gaagcgaaaa tgcaggaact ggcacaggtt tcccagaaac tgatggaaat cgcccagcag
     3601 caacatgccc agcagcagac tgccggtgct gatgcttctg caaacaacgc gaaagatgac
     3661 gatgttgtcg acgctgaatt tgaagaagtc aaagacaaaa aataatcgcc ctataaacgg
     3721 gtaattatac tgacacgggc gaaggggaat ttcctccccg cccgtgcatt catctagggg
     3781 caatttaaaa aagatggcta agcaagatta ttacgagatt ttaggcgttt ccaaaacagc
     3841 ggaagagcgt gaaatcagaa aggcctacaa acgcctggcc atgaaatacc acccggaccg
     3901 taaccagggt gacaaagagg ccgaggcgaa atttaaagag atcaaggaag cttatgaagt
     3961 tctgaccgac tcgcaaaaac gtgcggcata cgatcagtat ggtcatgctg cgtttgagca
     4021 aggtggcatg ggcggcggcg gttctggcgg cggcgcagac ttcagcgata tttttggtga
     4081 cgttttcggc gatatttttg gcggcggacg tggtcgtcaa cgtgcggcgc gcggtgctga
     4141 tttacgctat aacatggagc tcaccctcga agaagctgta cgtggcgtga ccaaagagat
     4201 ccgcattccg actctggaag agtgtgacgt ttgccacggt agcggtgcaa aaccaggtac
     4261 acagccgcag acttgtccga cctgtcatgg ttctggtcag gtgcagatgc gccagggatt
     4321 cttcgctgta cagcagacct gtccacactg tcagggccgc ggtacgctga tcaaagatcc
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart