pKK232- 8 Plasmid

$216.00

  • Model: PVT0826
  • 50 Units in Stock
Ask a question


Add to Cart:

pKK232-8

Search name

pKK232-8,Plasmid pKK232-8,pKK232-8 vector

 

pKK232-8 Information

Replicon: pBR322 ori
Terminator: rrnB T1
Plasmid classification: Escherichia coli vector; protein expression plasmid
Plasmid size: 5094bp
Prokaryotic resistance: ampicillin Amp
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Remarks: expression plasmids

 

pKK232-8 Descrption

PKK232-8 is a pKK series expression plasmid of Escherichia coli.

pKK232-8-Polyclonal-site

 

 

pKK232-8 Sequence

LOCUS       Exported                5094 bp ds-DNA     circular SYN 18-SEP-2016
DEFINITION  synthetic circular DNA
KEYWORDS    Untitled 5
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5094)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported 2016-9-18 from SnapGene Viewer 2.8.1
          
FEATURES             Location/Qualifiers
     source          1..5094
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     terminator      12..98
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     CDS             269..928
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQSHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     terminator      1363..1449
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      1541..1568
                     /note="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      1861..1947
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2039..2066
                     /note="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     CDS             2648..2839
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /note="rop"
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     misc_feature    2941..3081
                     /note="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(3267..3855)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(4026..4886)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(4887..4991)
                     /gene="bla"
                     /note="AmpR promoter"
ORIGIN
        1 ttcccaggca tcaaataaaa cgaaaggctc agtcgaaaga ctgggccttt cgttttatct
       61 gttgtttgtc ggtgaacgct ctcctgagta ggacaaatcc gccgggagcg gatttgaacg
      121 ttgcgaagca acggcccgga gggtggcggg caggacgccc gccataaact gccagggaat
      181 tcccggggat ccgtcgacct gcagccaagc ttgagtagga caaatccgcc gagcttcgac
      241 gagattttca ggagctaagg aagctaaaat ggagaaaaaa atcactggat ataccaccgt
      301 tgatatatcc caatcgcatc gtaaagaaca ttttgaggca tttcagtcag ttgctcaatg
      361 tacctataac cagaccgttc agctggatat tacggccttt ttaaagaccg taaagaaaaa
      421 taagcacaag ttttatccgg cctttattca cattcttgcc cgcctgatga atgctcatcc
      481 ggaattccgt atggcaatga aagacggtga gctggtgata tgggatagtg ttcacccttg
      541 ttacaccgtt ttccatgagc aaactgaaac gttttcatcg ctctggagtg aataccacga
      601 cgatttccgg cagtttctac acatatattc gcaagatgtg gcgtgttacg gtgaaaacct
      661 ggcctatttc cctaaagggt ttattgagaa tatgtttttc gtctcagcca atccctgggt
      721 gagtttcacc agttttgatt taaacgtggc caatatggac aacttcttcg cccccgtttt
      781 caccatgggc aaatattata cgcaaggcga caaggtgctg atgccgctgg cgattcaggt
      841 tcatcatgcc gtctgtgatg gcttccatgt cggcagaatg cttaatgaat tacaacagta
      901 ctgcgatgag tggcagggcg gggcgtaatt tttttaaggc agttattggt gcccttaaac
      961 gcctggtgct acgcctgaat aagtgataat aagcggatga atggcagaaa ttcgtcgagg
     1021 cggcacctcg ctaacggatt caccactcca agaattggag ccaatcaatt cttgcggaga
     1081 actgtgaatg cgcaaaccaa cccttggcag aacatatcca tcgcgtccgc catctccagc
     1141 agccgcacgc ggcgcatctc ggctgttttg gcggatgaga gaagattttc agcctgatac
     1201 agattaaatc agaacgcaga agcggtctga taaaacagaa tttgcctggc ggcagtagcg
     1261 cggtggtccc acctgacccc atgccgaact cagaagtgaa acgccgtagc gccgatggta
     1321 gtgtggggtc tccccatgcg agagtaggga actgccaggc atcaaataaa acgaaaggct
     1381 cagtcgaaag actgggcctt tcgttttatc tgttgtttgt cggtgaacgc tctcctgagt
     1441 aggacaaatc cgccgggagc ggatttgaac gttgcgaagc aacggcccgg agggtggcgg
     1501 gcaggacgcc cgccataaac tgccaggcat caaattaagc agaaggccat cctgacggat
     1561 ggcctttttg cgtttctaca aactcttcct gtcgtcatat ctacaagcca tccccccaca
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart