pLacZi

$193.00

  • Model: PVT11266
  • 50 Units in Stock
Ask a question


Add to Cart:

pLacZi


Catalog No. PVT11266
Packing 2ug

pLacZi Information
Function yeast Hybrid plasmid
Resistance Amp
Screen URA3
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pUC
Copy high
Promoter CYC1
Induction --
Forward primer
Reverse primer

 

pLacZi Description

PLacZi is a single hybrids of Saccharomyces cerevisiae.

 

pLacZi Sequence
 

LOCUS       Exported                6867 bp ds-DNA     circular SYN 06-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..6867

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             185..3322

                     /codon_start=1

                     /label=LacZI

                     /translation="MTGSGAWLLPVSLVKRKTTLAPNTQTASPRALADSLMQLARQVSR

                     LNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEAD

                     TVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRI

                     IFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQ

                     DMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVS

                     LWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTA

                     DGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDIL

                     LMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAM

                     SERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTA

                     TDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQ

                     AFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTP

                     HPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDV

                     APQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLP

                     AASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLD

                     NDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTL

                     FISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPD

                     RLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQL

                     METSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAELQLSAGRYHYQLVWCQK"

     rep_origin      complement(4019..4607)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(4778..5638)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(5639..5743)

                     /gene="bla"

                     /label=AmpR promoter

     CDS             complement(5848..6651)

                     /codon_start=1

                     /gene="S. cerevisiae URA3"

                     /product="orotidine-5'-phosphate decarboxylase, required 

                     for uracil biosynthesis"

                     /label=URA3

                     /note="yeast auxotrophic marker, counterselectable with 

                     5-fluoroorotic acid (5-FOA)"

                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL

                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ

                     YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE

                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD

                     VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"

     promoter        complement(6652..6867)

                     /gene="S. cerevisiae URA3"

                     /label=URA3 promoter

ORIGIN

        1 aagcttgaat tcgagctcgg tacccgggga tctgtcgacc tcgaggcatg tgctctgtat

       61 gtatataaaa ctcttgtttt cttcttttct ctaaatattc tttccttata cattaggtcc

      121 tttgtagcat aaattactat acttctatag acacgcaaac acaaatacac acactaaatt

      181 aataatgacc ggatccggag cttggctgtt gcccgtctca ctggtgaaaa gaaaaaccac

      241 cctggcgccc aatacgcaaa ccgcctctcc ccgcgcgttg gccgattcat taatgcagct

      301 ggcacgacag gtttcccgac ttaatcgcct tgcagcacat ccccctttcg ccagctggcg

      361 taatagcgaa gaggcccgca ccgatcgccc ttcccaacag ttgcgcagcc tgaatggcga

      421 atggcgcttt gcctggtttc cggcaccaga agcggtgccg gaaagctggc tggagtgcga

      481 tcttcctgag gccgatactg tcgtcgtccc ctcaaactgg cagatgcacg gttacgatgc

      541 gcccatctac accaacgtaa cctatcccat tacggtcaat ccgccgtttg ttcccacgga

      601 gaatccgacg ggttgttact cgctcacatt taatgttgat gaaagctggc tacaggaagg

      661 ccagacgcga attatttttg atggcgttaa ctcggcgttt catctgtggt gcaacgggcg

      721 ctgggtcggt tacggccagg acagtcgttt gccgtctgaa tttgacctga gcgcattttt

      781 acgcgccgga gaaaaccgcc tcgcggtgat ggtgctgcgt tggagtgacg gcagttatct

      841 ggaagatcag gatatgtggc ggatgagcgg cattttccgt gacgtctcgt tgctgcataa

      901 accgactaca caaatcagcg atttccatgt tgccactcgc tttaatgatg atttcagccg

      961 cgctgtactg gaggctgaag ttcagatgtg cggcgagttg cgtgactacc tacgggtaac

     1021 agtttcttta tggcagggtg aaacgcaggt cgccagcggc accgcgcctt tcggcggtga

     1081 aattatcgat gagcgtggtg gttatgccga tcgcgtcaca ctacgtctga acgtcgaaaa

     1141 cccgaaactg tggagcgccg aaatcccgaa tctctatcgt gcggtggttg aactgcacac

     1201 cgccgacggc acgctgattg aagcagaagc ctgcgatgtc ggtttccgcg aggtgcggat

     1261 tgaaaatggt ctgctgctgc tgaacggcaa gccgttgctg attcgaggcg ttaaccgtca

     1321 cgagcatcat cctctgcatg gtcaggtcat ggatgagcag acgatggtgc aggatatcct

     1381 gctgatgaag cagaacaact ttaacgccgt gcgctgttcg cattatccga accatccgct

     1441 gtggtacacg ctgtgcgacc gctacggcct gtatgtggtg gatgaagcca atattgaaac

     1501 ccacggcatg gtgccaatga atcgtctgac cgatgatccg cgctggctac cggcgatgag

     1561 cgaacgcgta acgcgaatgg tgcagcgcga tcgtaatcac ccgagtgtga tcatctggtc

     1621 gctggggaat gaatcaggcc acggcgctaa tcacgacgcg ctgtatcgct ggatcaaatc

     1681 tgtcgatcct tcccgcccgg tgcagtatga aggcggcgga gccgacacca cggccaccga

     1741 tattatttgc ccgatgtacg cgcgcgtgga tgaagaccag cccttcccgg ctgtgccgaa

     1801 atggtccatc aaaaaatggc tttcgctacc tggagagacg cgcccgctga tcctttgcga

     1861 atacgcccac gcgatgggta acagtcttgg cggtttcgct aaatactggc aggcgtttcg

     1921 tcagtatccc cgtttacagg gcggcttcgt ctgggactgg gtggatcagt cgctgattaa

     1981 atatgatgaa aacggcaacc cgtggtcggc ttacggcggt gattttggcg atacgccgaa

     2041 cgatcgccag ttctgtatga acggtctggt ctttgccgac cgcacgccgc atccagcgct

     2101 gacggaagca aaacaccagc agcagttttt ccagttccgt ttatccgggc aaaccatcga

     2161 agtgaccagc gaatacctgt tccgtcatag cgataacgag ctcctgcact ggatggtggc

     2221 gctggatggt aagccgctgg caagcggtga agtgcctctg gatgtcgctc cacaaggtaa

     2281 acagttgatt gaactgcctg aactaccgca gccggagagc gccgggcaac tctggctcac

     2341 agtacgcgta gtgcaaccga acgcgaccgc atggtcagaa gccgggcaca tcagcgcctg

     2401 gcagcagtgg cgtctggcgg aaaacctcag tgtgacgctc cccgccgcgt cccacgccat

     2461 cccgcatctg accaccagcg aaatggattt ttgcatcgag ctgggtaata agcgttggca

     2521 atttaaccgc cagtcaggct ttctttcaca gatgtggatt ggcgataaaa aacaactgct

     2581 gacgccgctg cgcgatcagt tcacccgtgc accgctggat aacgacattg gcgtaagtga

     2641 agcgacccgc attgacccta acgcctgggt cgaacgctgg aaggcggcgg gccattacca

     2701 ggccgaagca gcgttgttgc agtgcacggc agatacactt gctgatgcgg tgctgattac

     2761 gaccgctcac gcgtggcagc atcaggggaa aaccttattt atcagccgga aaacctaccg

     2821 gattgatggt agtggtcaaa tggcgattac cgttgatgtt gaagtggcga gcgatacacc

     2881 gcatccggcg cggattggcc tgaactgcca gctggcgcag gtagcagagc gggtaaactg

     2941 gctcggatta gggccgcaag aaaactatcc cgaccgcctt actgccgcct gttttgaccg

     3001 ctgggatctg ccattgtcag acatgtatac cccgtacgtc ttcccgagcg aaaacggtct

     3061 gcgctgcggg acgcgcgaat tgaattatgg cccacaccag tggcgcggcg acttccagtt

     3121 caacatcagc cgctacagtc aacagcaact gatggaaacc agccatcgcc atctgctgca

     3181 cgcggaagaa ggcacatggc tgaatatcga cggtttccat atggggattg gtggcgacga

     3241 ctcctggagc ccgtcagtat cggcggaatt acagctgagc gccggtcgct accattacca

     3301 gttggtctgg tgtcaaaaat aataataacc gggcaggcca tgtctgcccg tatttcgcgt

     3361 aaggaaatcc attatgtact atttaaaaaa cacaaacttt tggatgttcg gtttattctt

     3421 tttcttttac ttttttatca tgggagccta cttcccgttt ttcccgattt ggctacatga

     3481 catcaaccat atcagcaaaa gtgatacggg tattattttt gccgctattt ctctgttctc

     3541 gctattattc caaccgctgt ttggtctgct ttctgacaaa ctcggcctcg actctagcga

     3601 attaattcgt aatcatgtca tagctgtttc ctgtgtgaaa ttgttatccg ctcacaattc

     3661 cacacaacat acgagccgga agcataaagt gtaaagcctg gggtgcctaa tgagtgagct

     3721 aactcacatt aattgcgttg cgctcactgc ccgctttcca gtcgggaaac ctgtcgtgcc

     3781 agctgcatta atgaatcggc caacgcgcgg ggagaggcgg tttgcgtatt gggcgctctt

     3841 ccgcttcctc gctcactgac tcgctgcgct cggtcgttcg gctgcggcga gcggtatcag

     3901 ctcactcaaa ggcggtaata cggttatcca cagaatcagg ggataacgca ggaaagaaca

     3961 tgtgagcaaa aggccagcaa aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt

     4021 tccataggct ccgcccccct gacgagcatc acaaaaatcg acgctcaagt cagaggtggc

     4081 gaaacccgac aggactataa agataccagg cgtttccccc tggaagctcc ctcgtgcgct

     4141 ctcctgttcc gaccctgccg cttaccggat acctgtccgc ctttctccct tcgggaagcg

     4201 tggcgctttc tcatagctca cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca

     4261 agctgggctg tgtgcacgaa ccccccgttc agcccgaccg ctgcgcctta tccggtaact

     4321 atcgtcttga gtccaacccg gtaagacacg acttatcgcc actggcagca gccactggta

     4381 acaggattag cagagcgagg tatgtaggcg gtgctacaga gttcttgaag tggtggccta

     4441 actacggcta cactagaagg acagtatttg gtatctgcgc tctgctgaag ccagttacct

     4501 tcggaaaaag agttggtagc tcttgatccg gcaaacaaac caccgctggt agcggtggtt

     4561 tttttgtttg caagcagcag attacgcgca gaaaaaaagg atctcaagaa gatcctttga

     4621 tcttttctac ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca

     4681 tgagattatc aaaaaggatc ttcacctaga tccttttaaa ttaaaaatga agttttaaat

     4741 caatctaaag tatatatgag taaacttggt ctgacagtta ccaatgctta atcagtgagg

     4801 cacctatctc agcgatctgt ctatttcgtt catccatagt tgcctgactc cccgtcgtgt

     4861 agataactac gatacgggag ggcttaccat ctggccccag tgctgcaatg ataccgcgag

     4921 acccacgctc accggctcca gatttatcag caataaacca gccagccgga agggccgagc

     4981 gcagaagtgg tcctgcaact ttatccgcct ccatccagtc tattaattgt tgccgggaag

     5041 ctagagtaag tagttcgcca gttaatagtt tgcgcaacgt tgttgccatt gctacaggca

     5101 tcgtggtgtc acgctcgtcg tttggtatgg cttcattcag ctccggttcc caacgatcaa

     5161 ggcgagttac atgatccccc atgttgtgca aaaaagcggt tagctccttc ggtcctccga

     5221 tcgttgtcag aagtaagttg gccgcagtgt tatcactcat ggttatggca gcactgcata

     5281 attctcttac tgtcatgcca tccgtaagat gcttttctgt gactggtgag tactcaacca

     5341 agtcattctg agaatagtgt atgcggcgac cgagttgctc ttgcccggcg tcaatacggg

     5401 ataataccgc gccacatagc agaactttaa aagtgctcat cattggaaaa cgttcttcgg

     5461 ggcgaaaact ctcaaggatc ttaccgctgt tgagatccag ttcgatgtaa cccactcgtg

     5521 cacccaactg atcttcagca tcttttactt tcaccagcgt ttctgggtga gcaaaaacag

     5581 gaaggcaaaa tgccgcaaaa aagggaataa gggcgacacg gaaatgttga atactcatac

     5641 tcttcctttt tcaatattat tgaagcattt atcagggtta ttgtctcatg agcggataca

     5701 tatttgaatg tatttagaaa aataaacaaa taggggttcc gcgcacattt ccccgaaaag

     5761 tgccacctgg gtaataactc gatataatta aattgaagct ctaatttgtg agtttagtat

     5821 acatgcattt acttataata cagtttttta gttttgctgg ccgcatcttc tcaaatatgc

     5881 ttcccagcct gcttttctgt aacgttcacc ctctacctta gcatcccttc cctttgcaaa

     5941 tagtcctctt ccaacaataa taatgtcaga tcctgtagag accacatcat ccacggttct

     6001 atactgttga cccaatgcgt ctcccttgtc atctaaaccc acaccgggtg tcataatcaa

     6061 ccaatcgtaa ccttcatctc ttccacccat gtctctttga gcaataaagc cgataacaaa

     6121 atctttgtcg ctcttcgcaa tgtcaacagt acccttagta tattctccag tagataggga

     6181 gcccttgcat gacaattctg ctaacatcaa aaggcctcta ggttcctttg ttacttcttc

     6241 tgccgcctgc ttcaaaccgc taacaatacc tgggcccacc acaccgtgtg cattcgtaat

     6301 gtctgcccat tctgctattc tgtatacacc cgcagagtac tgcaatttga ctgtattacc

     6361 aatgtcagca aattttctgt cttcgaagag taaaaaattg tacttggcgg ataatgcctt

     6421 tagcggctta actgtgccct ccatggaaaa atcagtcaag atatccacat gtgtttttag

     6481 taaacaaatt ttgggaccta atgcttcaac taactccagt aattccttgg tggtacgaac

     6541 atccaatgaa gcacacaagt ttgtttgctt ttcgtgcatg atattaaata gcttggcagc

     6601 aacaggacta ggatgagtag cagcacgttc cttatatgta gctttcgaca tgatttatct

     6661 tcgtttcctg caggtttttg ttctgtgcag ttgggttaag aatactgggc aatttcatgt

     6721 ttcttcaaca ctacatatgc gtatatatac caatctaagt ctgtgctcct tccttcgttc

     6781 ttccttctgt tcggagatta ccgaatcaaa aaaatttcaa ggaaaccgaa atcaaaaaaa

     6841 agaataaaaa aaaaatgatg aattgaa

//

*Caution
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart