pLP/ VSVG Plasmid

$169.00

  • Model: PVT2326
  • 49 Units in Stock
Ask a question


Add to Cart:

pLP/ VSVG

PVT2326      2ug
 

 

pLP/ VSVG Information

Promoter: CMV

Replicon: pUC ori

Terminator: beta -globin poly (A)

Plasmid classification: virus series, lentivirus packaging carrier

Plasmid size: 5821bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pLP/ VSVG Decription

pLP1, pLP2, and pLP/VSVG. These plasmids supply the helper functions as well as structural and replication proteins in trans required to produce a recombinant lentivirus, containing your gene of interest, using our Lentiviral Expression System.

pLP-VSVG-vector

 

pLP/ VSVG Publication

FOXO3a‑SIRT6 axis suppresses aerobic glycolysis in melanoma

International Journal of Oncology
Authors: Zhen Dong Jie Yang Lin Li Li Tan Pengfei Shi Jiayi Zhang Xi Zhong Lingjun Ge Zonghui Wu Hongjuan Cui
Published online on: January 17, 2020     https://doi.org/10.3892/ijo.2020.4964
Pages: 728-742

 

pLP/ VSVG Sequence

LOCUS       Exported                5821 bp ds-DNA     circular SYN 08-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5821)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Thursday, September 8, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..5821

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        79..458

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        459..662

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     intron          796..1271

                     /note="beta-globin intron"

                     /note="internally truncated intron from human beta-globin"

     CDS             1346..2881

                     /codon_start=1

                     /product="vesicular stomatitis virus G glycoprotein"

                     /note="VSV-G"

                     /note="Indiana strain"

                     /translation="MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSD

                     LNWHNDLIGTALQVKMPKSHKAIQADGWMCHASKWVTTCDFRWYGPKYITHSIRSFTPS

                     VEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAVIVQVTPHHVLVDEYTGEWVDSQ

                     FINGKCSNYICPTVHNSTTWHSDYKVKGLCDSNLISMDITFFSEDGELSSLGKEGTGFR

                     SNYFAYETGGKACKMQYCKHWGVRLPSGVWFEMADKDLFAAARFPECPEGSSISAPSQT

                     SVDVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSYLAPKNPGTGPAFTIINGTLK

                     YFETRYIRVDIAAPILSRMVGMISGTTTERELWDDWAPYEDVEIGPNGVLRTSSGYKFP

                     LYMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDDESLFFGDTGLSKNPIELVEGWF

                     SSWKSSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTKKRQIYTDIEMNRLGK"

     polyA_site      3082..3476

                     /note="beta-globin poly(A)"

                     /note="human beta-globin polyadenylation signal"

     rep_origin      complement(3986..4574)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(4745..5605)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(5606..5710)

                     /gene="bla"

                     /note="AmpR promoter"

ORIGIN

        1 ttggcccatt gcatacgttg tatccatatc ataatatgta catttatatt ggctcatgtc

       61 caacattacc gccatgttga cattgattat tgactagtta ttaatagtaa tcaattacgg

      121 ggtcattagt tcatagccca tatatggagt tccgcgttac ataacttacg gtaaatggcc

      181 cgcctggctg accgcccaac gacccccgcc cattgacgtc aataatgacg tatgttccca

      241 tagtaacgcc aatagggact ttccattgac gtcaatgggt ggagtattta cggtaaactg

      301 cccacttggc agtacatcaa gtgtatcata tgccaagtac gccccctatt gacgtcaatg

      361 acggtaaatg gcccgcctgg cattatgccc agtacatgac cttatgggac tttcctactt

      421 ggcagtacat ctacgtatta gtcatcgcta ttaccatggt gatgcggttt tggcagtaca

      481 tcaatgggcg tggatagcgg tttgactcac ggggatttcc aagtctccac cccattgacg

      541 tcaatgggag tttgttttgg caccaaaatc aacgggactt tccaaaatgt cgtaacaact

      601 ccgccccatt gacgcaaatg ggcggtaggc gtgtacggtg ggaggtctat ataagcagag

      661 ctcgtttagt gaaccgtcag atcgcctgga gacgccatcc acgctgtttt gacctccata

      721 gaagacaccg ggaccgatcc agcctcccct cgaagcttac atgtggtacc gagctcggat

      781 cctgagaact tcagggtgag tctatgggac ccttgatgtt ttctttcccc ttcttttcta

      841 tggttaagtt catgtcatag gaaggggaga agtaacaggg tacacatatt gaccaaatca

      901 gggtaatttt gcatttgtaa ttttaaaaaa tgctttcttc ttttaatata cttttttgtt

      961 tatcttattt ctaatacttt ccctaatctc tttctttcag ggcaataatg atacaatgta

     1021 tcatgcctct ttgcaccatt ctaaagaata acagtgataa tttctgggtt aaggcaatag

     1081 caatatttct gcatataaat atttctgcat ataaattgta actgatgtaa gaggtttcat

     1141 attgctaata gcagctacaa tccagctacc attctgcttt tattttatgg ttgggataag

     1201 gctggattat tctgagtcca agctaggccc ttttgctaat catgttcata cctcttatct

     1261 tcctcccaca gctcctgggc aacgtgctgg tctgtgtgct ggcccatcac tttggcaaag

     1321 cacgtgagat ctgaattctg acactatgaa gtgccttttg tacttagcct ttttattcat

     1381 tggggtgaat tgcaagttca ccatagtttt tccacacaac caaaaaggaa actggaaaaa

     1441 tgttccttct aattaccatt attgcccgtc aagctcagat ttaaattggc ataatgactt

     1501 aataggcaca gccttacaag tcaaaatgcc caagagtcac aaggctattc aagcagacgg

     1561 ttggatgtgt catgcttcca aatgggtcac tacttgtgat ttccgctggt atggaccgaa

     1621 gtatataaca cattccatcc gatccttcac tccatctgta gaacaatgca aggaaagcat

     1681 tgaacaaacg aaacaaggaa cttggctgaa tccaggcttc cctcctcaaa gttgtggata

     1741 tgcaactgtg acggatgccg aagcagtgat tgtccaggtg actcctcacc atgtgctggt

     1801 tgatgaatac acaggagaat gggttgattc acagttcatc aacggaaaat gcagcaatta

     1861 catatgcccc actgtccata actctacaac ctggcattct gactataagg tcaaagggct

     1921 atgtgattct aacctcattt ccatggacat caccttcttc tcagaggacg gagagctatc

     1981 atccctggga aaggagggca cagggttcag aagtaactac tttgcttatg aaactggagg

     2041 caaggcctgc aaaatgcaat actgcaagca ttggggagtc agactcccat caggtgtctg

     2101 gttcgagatg gctgataagg atctctttgc tgcagccaga ttccctgaat gcccagaagg

     2161 gtcaagtatc tctgctccat ctcagacctc agtggatgta agtctaattc aggacgttga

     2221 gaggatcttg gattattccc tctgccaaga aacctggagc aaaatcagag cgggtcttcc

     2281 aatctctcca gtggatctca gctatcttgc tcctaaaaac ccaggaaccg gtcctgcttt

     2341 caccataatc aatggtaccc taaaatactt tgagaccaga tacatcagag tcgatattgc

     2401 tgctccaatc ctctcaagaa tggtcggaat gatcagtgga actaccacag aaagggaact

     2461 gtgggatgac tgggcaccat atgaagacgt ggaaattgga cccaatggag ttctgaggac

     2521 cagttcagga tataagtttc ctttatacat gattggacat ggtatgttgg actccgatct

     2581 tcatcttagc tcaaaggctc aggtgttcga acatcctcac attcaagacg ctgcttcgca

     2641 acttcctgat gatgagagtt tattttttgg tgatactggg ctatccaaaa atccaatcga

     2701 gcttgtagaa ggttggttca gtagttggaa aagctctatt gcctcttttt tctttatcat

     2761 agggttaatc attggactat tcttggttct ccgagttggt atccatcttt gcattaaatt

     2821 aaagcacacc aagaaaagac agatttatac agacatagag atgaaccgac ttggaaagta

     2881 actcaaatcc tgcacaacag attcttcatg tttggaccaa atcaacttgt gataccatgc

     2941 tcaaagaggc ctcaattata tttgagtttt taatttttat gaaaaaaaaa aaaaaaaacg

     3001 gaattcaccc caccagtgca ggctgcctat cagaaagtgg tggctggtgt ggctaatgcc

     3061 ctggcccaca agtatcacta agctcgcttt cttgctgtcc aatttctatt aaaggttcct

     3121 ttgttcccta agtccaacta ctaaactggg ggatattatg aagggccttg agcatctgga

     3181 ttctgcctaa taaaaaacat ttattttcat tgcaatgatg tatttaaatt atttctgaat

     3241 attttactaa aaagggaatg tgggaggtca gtgcatttaa aacataaaga aatgaagagc

     3301 tagttcaaac cttgggaaaa tacactatat cttaaactcc atgaaagaag gtgaggctgc

     3361 aaacagctaa tgcacattgg caacagcccc tgatgcctat gccttattca tccctcagaa

     3421 aaggattcaa gtagaggctt gatttggagg ttaaagtttt gctatgctgt attttacatt

     3481 acttattgtt ttagctgtcc tcatgaatgt cttttcacta cccatttgct tatcctgcat

     3541 ctctcagcct tgactccact cagttctctt gcttagagat accacctttc ccctgaagtg

     3601 ttccttccat gttttacggc gagatggttt ctcctcgcct ggccactcag ccttagttgt

     3661 ctctgttgtc ttatagaggt ctacttgaag aaggaaaaac agggggcatg gtttgactgt

     3721 cctgtgagcc cttcttccct gcctccccca ctcacagtga cccggaatcc ctcgacatgg

     3781 cagtctagca ctagtgcggc cgcagatctg cttcctcgct cactgactcg ctgcgctcgg

     3841 tcgttcggct gcggcgagcg gtatcagctc actcaaaggc ggtaatacgg ttatccacag

     3901 aatcagggga taacgcagga aagaacatgt gagcaaaagg ccagcaaaag gccaggaacc

     3961 gtaaaaaggc cgcgttgctg gcgtttttcc ataggctccg cccccctgac gagcatcaca

     4021 aaaatcgacg ctcaagtcag aggtggcgaa acccgacagg actataaaga taccaggcgt

     4081 ttccccctgg aagctccctc gtgcgctctc ctgttccgac cctgccgctt accggatacc

     4141 tgtccgcctt tctcccttcg ggaagcgtgg cgctttctca tagctcacgc tgtaggtatc

     4201 tcagttcggt gtaggtcgtt cgctccaagc tgggctgtgt gcacgaaccc cccgttcagc

     4261 ccgaccgctg cgccttatcc ggtaactatc gtcttgagtc caacccggta agacacgact

     4321 tatcgccact ggcagcagcc actggtaaca ggattagcag agcgaggtat gtaggcggtg

     4381 ctacagagtt cttgaagtgg tggcctaact acggctacac tagaagaaca gtatttggta

     4441 tctgcgctct gctgaagcca gttaccttcg gaaaaagagt tggtagctct tgatccggca

     4501 aacaaaccac cgctggtagc ggtggttttt ttgtttgcaa gcagcagatt acgcgcagaa

     4561 aaaaaggatc tcaagaagat cctttgatct tttctacggg gtctgacgct cagtggaacg

     4621 aaaactcacg ttaagggatt ttggtcatga gattatcaaa aaggatcttc acctagatcc

     4681 ttttaaatta aaaatgaagt tttaaatcaa tctaaagtat atatgagtaa acttggtctg

     4741 acagttacca atgcttaatc agtgaggcac ctatctcagc gatctgtcta tttcgttcat

     4801 ccatagttgc ctgactcccc gtcgtgtaga taactacgat acgggagggc ttaccatctg

     4861 gccccagtgc tgcaatgata ccgcgagacc cacgctcacc ggctccagat ttatcagcaa

     4921 taaaccagcc agccggaagg gccgagcgca gaagtggtcc tgcaacttta tccgcctcca

     4981 tccagtctat taattgttgc cgggaagcta gagtaagtag ttcgccagtt aatagtttgc

     5041 gcaacgttgt tgccattgct acaggcatcg tggtgtcacg ctcgtcgttt ggtatggctt

     5101 cattcagctc cggttcccaa cgatcaaggc gagttacatg atcccccatg ttgtgcaaaa

     5161 aagcggttag ctccttcggt cctccgatcg ttgtcagaag taagttggcc gcagtgttat

     5221 cactcatggt tatggcagca ctgcataatt ctcttactgt catgccatcc gtaagatgct

     5281 tttctgtgac tggtgagtac tcaaccaagt cattctgaga atagtgtatg cggcgaccga

     5341 gttgctcttg cccggcgtca atacgggata ataccgcgcc acatagcaga actttaaaag

     5401 tgctcatcat tggaaaacgt tcttcggggc gaaaactctc aaggatctta ccgctgttga

     5461 gatccagttc gatgtaaccc actcgtgcac ccaactgatc ttcagcatct tttactttca

     5521 ccagcgtttc tgggtgagca aaaacaggaa ggcaaaatgc cgcaaaaaag ggaataaggg

     5581 cgacacggaa atgttgaata ctcatactct tcctttttca atattattga agcatttatc

     5641 agggttattg tctcatgagc ggatacatat ttgaatgtat ttagaaaaat aaacaaatag

     5701 gggttccgcg cacatttccc cgaaaagtgc cacctgacgg gatcccctga gggggccccc

     5761 atgggctaga ggatccggcc tcggcctctg cataaataaa aaaaattagt cagccatgag

     5821 c

//

 

Caution:
Product is for research use only!



Search name

pLP/VSVG,Plasmid pLP/VSVG,pLP/VSVG vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart