pLP1

$136.00

  • Model: PVT2324
  • 49 Units in Stock
Ask a question


Add to Cart:

pLP1

PVT2324    2ug

 

pLP1 Information

Promoter: CMV

Replicon: pUC ori

Terminator: beta -globin poly (A)

Plasmid classification: virus series, lentivirus packaging carrier

Plasmid size: 8889bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pLP1 Description

PLP1 (Proteolipid Protein 1) is a Protein Coding gene. Diseases associated with PLP1 include pelizaeus-merzbacher disease and spastic paraplegia 2, x-linked. Among its related pathways are Glial Cell Differentiation and SIDS Susceptibility Pathways. GO annotations related to this gene include structural molecule activity and structural constituent of myelin sheath. An important paralog of this gene is GPM6B.

 

pLP1 Sequence

LOCUS       Exported                8889 bp ds-DNA     circular SYN 27-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 32

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 8889)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Saturday, August 27, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..8889

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        79..458

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        459..662

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     intron          796..1271

                     /note="beta-globin intron"

                     /note="internally truncated intron from human beta-globin"

     CDS             1355..2857

                     /codon_start=1

                     /gene="gag"

                     /product="gag protein from human immunodeficiency virus 1"

                     /note="HIV-1 gag"

                     /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFA

                     VNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKI

                     EEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKA

                     FSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGP

                     IAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTS

                     ILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPG

                     ATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEG

                     HIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAP

                     PEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ"

     CDS             2650..5661

                     /codon_start=1

                     /gene="pol"

                     /product="pol protein from human immunodeficiency virus 1"

                     /note="HIV-1 pol"

                     /translation="FFREDLAFPQGKAREFSSEQTRANSPTRRELQVWGRDNNSLSEAG

                     ADRQGTVSFSFPQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIG

                     GIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETV

                     PVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKD

                     STKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRK

                     YTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMD

                     DLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

                     VLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELEL

                     AENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHT

                     NDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTPP

                     LVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ

                     AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAH

                     KGIGGNEQVDKLVSAGIRKVLFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVA

                     SCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQET

                     AYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNK

                     ELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQK

                     QITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQ

                     MAGDDCVASRQDED"

     misc_feature    5346..5463

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1"

     misc_feature    5686..5919

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     polyA_site      6150..6544

                     /note="beta-globin poly(A)"

                     /note="human beta-globin polyadenylation signal"

     rep_origin      complement(7054..7642)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7813..8673)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(8674..8778)

                     /gene="bla"

                     /note="AmpR promoter"

ORIGIN

        1 ttggcccatt gcatacgttg tatccatatc ataatatgta catttatatt ggctcatgtc

       61 caacattacc gccatgttga cattgattat tgactagtta ttaatagtaa tcaattacgg

      121 ggtcattagt tcatagccca tatatggagt tccgcgttac ataacttacg gtaaatggcc

      181 cgcctggctg accgcccaac gacccccgcc cattgacgtc aataatgacg tatgttccca

      241 tagtaacgcc aatagggact ttccattgac gtcaatgggt ggagtattta cggtaaactg

      301 cccacttggc agtacatcaa gtgtatcata tgccaagtac gccccctatt gacgtcaatg

      361 acggtaaatg gcccgcctgg cattatgccc agtacatgac cttatgggac tttcctactt

      421 ggcagtacat ctacgtatta gtcatcgcta ttaccatggt gatgcggttt tggcagtaca

      481 tcaatgggcg tggatagcgg tttgactcac ggggatttcc aagtctccac cccattgacg

      541 tcaatgggag tttgttttgg caccaaaatc aacgggactt tccaaaatgt cgtaacaact

      601 ccgccccatt gacgcaaatg ggcggtaggc gtgtacggtg ggaggtctat ataagcagag

      661 ctcgtttagt gaaccgtcag atcgcctgga gacgccatcc acgctgtttt gacctccata

      721 gaagacaccg ggaccgatcc agcctcccct cgaagcttac atgtggtacc gagctcggat

      781 cctgagaact tcagggtgag tctatgggac ccttgatgtt ttctttcccc ttcttttcta

      841 tggttaagtt catgtcatag gaaggggaga agtaacaggg tacacatatt gaccaaatca

      901 gggtaatttt gcatttgtaa ttttaaaaaa tgctttcttc ttttaatata cttttttgtt

      961 tatcttattt ctaatacttt ccctaatctc tttctttcag ggcaataatg atacaatgta

     1021 tcatgcctct ttgcaccatt ctaaagaata acagtgataa tttctgggtt aaggcaatag

     1081 caatatttct gcatataaat atttctgcat ataaattgta actgatgtaa gaggtttcat

     1141 attgctaata gcagctacaa tccagctacc attctgcttt tattttatgg ttgggataag

     1201 gctggattat tctgagtcca agctaggccc ttttgctaat catgttcata cctcttatct

     1261 tcctcccaca gctcctgggc aacgtgctgg tctgtgtgct ggcccatcac tttggcaaag

     1321 cacgtgagat ctgaattcga gatctgccgc cgccatgggt gcgagagcgt cagtattaag

     1381 cgggggagaa ttagatcgat gggaaaaaat tcggttaagg ccagggggaa agaaaaaata

     1441 taaattaaaa catatagtat gggcaagcag ggagctagaa cgattcgcag ttaatcctgg

     1501 cctgttagaa acatcagaag gctgtagaca aatactggga cagctacaac catcccttca

     1561 gacaggatca gaagaactta gatcattata taatacagta gcaaccctct attgtgtgca

     1621 tcaaaggata gagataaaag acaccaagga agctttagac aagatagagg aagagcaaaa

     1681 caaaagtaag aaaaaagcac agcaagcagc agctgacaca ggacacagca atcaggtcag

     1741 ccaaaattac cctatagtgc agaacatcca ggggcaaatg gtacatcagg ccatatcacc

     1801 tagaacttta aatgcatggg taaaagtagt agaagagaag gctttcagcc cagaagtgat

     1861 acccatgttt tcagcattat cagaaggagc caccccacaa gatttaaaca ccatgctaaa

     1921 cacagtgggg ggacatcaag cagccatgca aatgttaaaa gagaccatca atgaggaagc

     1981 tgcagaatgg gatagagtgc atccagtgca tgcagggcct attgcaccag gccagatgag

     2041 agaaccaagg ggaagtgaca tagcaggaac tactagtacc cttcaggaac aaataggatg

     2101 gatgacacat aatccaccta tcccagtagg agaaatctat aaaagatgga taatcctggg

     2161 attaaataaa atagtaagaa tgtatagccc taccagcatt ctggacataa gacaaggacc

     2221 aaaggaaccc tttagagact atgtagaccg attctataaa actctaagag ccgagcaagc

     2281 ttcacaagag gtaaaaaatt ggatgacaga aaccttgttg gtccaaaatg cgaacccaga

     2341 ttgtaagact attttaaaag cattgggacc aggagcgaca ctagaagaaa tgatgacagc

     2401 atgtcaggga gtggggggac ccggccataa agcaagagtt ttggctgaag caatgagcca

     2461 agtaacaaat ccagctacca taatgataca gaaaggcaat tttaggaacc aaagaaagac

     2521 tgttaagtgt ttcaattgtg gcaaagaagg gcacatagcc aaaaattgca gggcccctag

     2581 gaaaaagggc tgttggaaat gtggaaagga aggacaccaa atgaaagatt gtactgagag

     2641 acaggctaat tttttaggga agatctggcc ttcccacaag ggaaggccag ggaattttct

     2701 tcagagcaga ccagagccaa cagccccacc agaagagagc ttcaggtttg gggaagagac

     2761 aacaactccc tctcagaagc aggagccgat agacaaggaa ctgtatcctt tagcttccct

     2821 cagatcactc tttggcagcg acccctcgtc acaataaaga taggggggca attaaaggaa

     2881 gctctattag atacaggagc agatgataca gtattagaag aaatgaattt gccaggaaga

     2941 tggaaaccaa aaatgatagg gggaattgga ggttttatca aagtaagaca gtatgatcag

     3001 atactcatag aaatctgcgg acataaagct ataggtacag tattagtagg acctacacct

     3061 gtcaacataa ttggaagaaa tctgttgact cagattggct gcactttaaa ttttcccatt

     3121 agtcctattg agactgtacc agtaaaatta aagccaggaa tggatggccc aaaagttaaa

     3181 caatggccat tgacagaaga aaaaataaaa gcattagtag aaatttgtac agaaatggaa

     3241 aaggaaggaa aaatttcaaa aattgggcct gaaaatccat acaatactcc agtatttgcc

     3301 ataaagaaaa aagacagtac taaatggaga aaattagtag atttcagaga acttaataag

     3361 agaactcaag atttctggga agttcaatta ggaataccac atcctgcagg gttaaaacag

     3421 aaaaaatcag taacagtact ggatgtgggc gatgcatatt tttcagttcc cttagataaa

     3481 gacttcagga agtatactgc atttaccata cctagtataa acaatgagac accagggatt

     3541 agatatcagt acaatgtgct tccacaggga tggaaaggat caccagcaat attccagtgt

     3601 agcatgacaa aaatcttaga gccttttaga aaacaaaatc cagacatagt catctatcaa

     3661 tacatggatg atttgtatgt aggatctgac ttagaaatag ggcagcatag aacaaaaata

     3721 gaggaactga gacaacatct gttgaggtgg ggatttacca caccagacaa aaaacatcag

     3781 aaagaacctc cattcctttg gatgggttat gaactccatc ctgataaatg gacagtacag

     3841 cctatagtgc tgccagaaaa ggacagctgg actgtcaatg acatacagaa attagtggga

     3901 aaattgaatt gggcaagtca gatttatgca gggattaaag taaggcaatt atgtaaactt

     3961 cttaggggaa ccaaagcact aacagaagta gtaccactaa cagaagaagc agagctagaa

     4021 ctggcagaaa acagggagat tctaaaagaa ccggtacatg gagtgtatta tgacccatca

     4081 aaagacttaa tagcagaaat acagaagcag gggcaaggcc aatggacata tcaaatttat

     4141 caagagccat ttaaaaatct gaaaacagga aagtatgcaa gaatgaaggg tgcccacact

     4201 aatgatgtga aacaattaac agaggcagta caaaaaatag ccacagaaag catagtaata

     4261 tggggaaaga ctcctaaatt taaattaccc atacaaaagg aaacatggga agcatggtgg

     4321 acagagtatt ggcaagccac ctggattcct gagtgggagt ttgtcaatac ccctccctta

     4381 gtgaagttat ggtaccagtt agagaaagaa cccataatag gagcagaaac tttctatgta

     4441 gatggggcag ccaataggga aactaaatta ggaaaagcag gatatgtaac tgacagagga

     4501 agacaaaaag ttgtccccct aacggacaca acaaatcaga agactgagtt acaagcaatt

     4561 catctagctt tgcaggattc gggattagaa gtaaacatag tgacagactc acaatatgca

     4621 ttgggaatca ttcaagcaca accagataag agtgaatcag agttagtcag tcaaataata

     4681 gagcagttaa taaaaaagga aaaagtctac ctggcatggg taccagcaca caaaggaatt

     4741 ggaggaaatg aacaagtaga taaattggtc agtgctggaa tcaggaaagt actattttta

     4801 gatggaatag ataaggccca agaagaacat gagaaatatc acagtaattg gagagcaatg

     4861 gctagtgatt ttaacctacc acctgtagta gcaaaagaaa tagtagccag ctgtgataaa

     4921 tgtcagctaa aaggggaagc catgcatgga caagtagact gtagcccagg aatatggcag

     4981 ctagattgta cacatttaga aggaaaagtt atcttggtag cagttcatgt agccagtgga

     5041 tatatagaag cagaagtaat tccagcagag acagggcaag aaacagcata cttcctctta

     5101 aaattagcag gaagatggcc agtaaaaaca gtacatacag acaatggcag caatttcacc

     5161 agtactacag ttaaggccgc ctgttggtgg gcggggatca agcaggaatt tggcattccc

     5221 tacaatcccc aaagtcaagg agtaatagaa tctatgaata aagaattaaa gaaaattata

     5281 ggacaggtaa gagatcaggc tgaacatctt aagacagcag tacaaatggc agtattcatc

     5341 cacaatttta aaagaaaagg ggggattggg gggtacagtg caggggaaag aatagtagac

     5401 ataatagcaa cagacataca aactaaagaa ttacaaaaac aaattacaaa aattcaaaat

     5461 tttcgggttt attacaggga cagcagagat ccagtttgga aaggaccagc aaagctcctc

     5521 tggaaaggtg aaggggcagt agtaatacaa gataatagtg acataaaagt agtgccaaga

     5581 agaaaagcaa agatcatcag ggattatgga aaacagatgg caggtgatga ttgtgtggca

     5641 agtagacagg atgaggatta acacatggaa ttccggagcg gccgcaggag ctttgttcct

     5701 tgggttcttg ggagcagcag gaagcactat gggcgcagcg tcaatgacgc tgacggtaca

     5761 ggccagacaa ttattgtctg gtatagtgca gcagcagaac aatttgctga gggctattga

     5821 ggcgcaacag catctgttgc aactcacagt ctggggcatc aagcagctcc aggcaagaat

     5881 cctggctgtg gaaagatacc taaaggatca acagctcctg gggatttggg gttgctctgg

     5941 aaaactcatt tgcaccactg ctgtgccttg gaatgctagt tggagtaata aatctctgga

     6001 acagatttgg aatcacacga cctggatgga gtgggacaga gaaattaaca attacacaag

     6061 cttccgcgga attcacccca ccagtgcagg ctgcctatca gaaagtggtg gctggtgtgg

     6121 ctaatgccct ggcccacaag tatcactaag ctcgctttct tgctgtccaa tttctattaa

     6181 aggttccttt gttccctaag tccaactact aaactggggg atattatgaa gggccttgag

     6241 catctggatt ctgcctaata aaaaacattt attttcattg caatgatgta tttaaattat

     6301 ttctgaatat tttactaaaa agggaatgtg ggaggtcagt gcatttaaaa cataaagaaa

     6361 tgaagagcta gttcaaacct tgggaaaata cactatatct taaactccat gaaagaaggt

     6421 gaggctgcaa acagctaatg cacattggca acagcccctg atgcctatgc cttattcatc

     6481 cctcagaaaa ggattcaagt agaggcttga tttggaggtt aaagttttgc tatgctgtat

     6541 tttacattac ttattgtttt agctgtcctc atgaatgtct tttcactacc catttgctta

     6601 tcctgcatct ctcagccttg actccactca gttctcttgc ttagagatac cacctttccc

     6661 ctgaagtgtt ccttccatgt tttacggcga gatggtttct cctcgcctgg ccactcagcc

     6721 ttagttgtct ctgttgtctt atagaggtct acttgaagaa ggaaaaacag ggggcatggt

     6781 ttgactgtcc tgtgagccct tcttccctgc ctcccccact cacagtgacc cggaatccct

     6841 cgacatggca gtctagcact agtgcggccg cagatctgct tcctcgctca ctgactcgct

     6901 gcgctcggtc gttcggctgc ggcgagcggt atcagctcac tcaaaggcgg taatacggtt

     6961 atccacagaa tcaggggata acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc

     7021 caggaaccgt aaaaaggccg cgttgctggc gtttttccat aggctccgcc cccctgacga

     7081 gcatcacaaa aatcgacgct caagtcagag gtggcgaaac ccgacaggac tataaagata

     7141 ccaggcgttt ccccctggaa gctccctcgt gcgctctcct gttccgaccc tgccgcttac

     7201 cggatacctg tccgcctttc tcccttcggg aagcgtggcg ctttctcata gctcacgctg

     7261 taggtatctc agttcggtgt aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc

     7321 cgttcagccc gaccgctgcg ccttatccgg taactatcgt cttgagtcca acccggtaag

     7381 acacgactta tcgccactgg cagcagccac tggtaacagg attagcagag cgaggtatgt

     7441 aggcggtgct acagagttct tgaagtggtg gcctaactac ggctacacta gaagaacagt

     7501 atttggtatc tgcgctctgc tgaagccagt taccttcgga aaaagagttg gtagctcttg

     7561 atccggcaaa caaaccaccg ctggtagcgg tggttttttt gtttgcaagc agcagattac

     7621 gcgcagaaaa aaaggatctc aagaagatcc tttgatcttt tctacggggt ctgacgctca

     7681 gtggaacgaa aactcacgtt aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac

     7741 ctagatcctt ttaaattaaa aatgaagttt taaatcaatc taaagtatat atgagtaaac

     7801 ttggtctgac agttaccaat gcttaatcag tgaggcacct atctcagcga tctgtctatt

     7861 tcgttcatcc atagttgcct gactccccgt cgtgtagata actacgatac gggagggctt

     7921 accatctggc cccagtgctg caatgatacc gcgagaccca cgctcaccgg ctccagattt

     7981 atcagcaata aaccagccag ccggaagggc cgagcgcaga agtggtcctg caactttatc

     8041 cgcctccatc cagtctatta attgttgccg ggaagctaga gtaagtagtt cgccagttaa

     8101 tagtttgcgc aacgttgttg ccattgctac aggcatcgtg gtgtcacgct cgtcgtttgg

     8161 tatggcttca ttcagctccg gttcccaacg atcaaggcga gttacatgat cccccatgtt

     8221 gtgcaaaaaa gcggttagct ccttcggtcc tccgatcgtt gtcagaagta agttggccgc

     8281 agtgttatca ctcatggtta tggcagcact gcataattct cttactgtca tgccatccgt

     8341 aagatgcttt tctgtgactg gtgagtactc aaccaagtca ttctgagaat agtgtatgcg

     8401 gcgaccgagt tgctcttgcc cggcgtcaat acgggataat accgcgccac atagcagaac

     8461 tttaaaagtg ctcatcattg gaaaacgttc ttcggggcga aaactctcaa ggatcttacc

     8521 gctgttgaga tccagttcga tgtaacccac tcgtgcaccc aactgatctt cagcatcttt

     8581 tactttcacc agcgtttctg ggtgagcaaa aacaggaagg caaaatgccg caaaaaaggg

     8641 aataagggcg acacggaaat gttgaatact catactcttc ctttttcaat attattgaag

     8701 catttatcag ggttattgtc tcatgagcgg atacatattt gaatgtattt agaaaaataa

     8761 acaaataggg gttccgcgca catttccccg aaaagtgcca cctgacggga tcccctgagg

     8821 gggcccccat gggctagagg atccggcctc ggcctctgca taaataaaaa aaattagtca

     8881 gccatgagc

//

 

Caution:
Product is for research use only!

 

Search name

pLP1,Plasmid pLP1,pLP1 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart