pLP2

$160.00

  • Model: PVT2325
  • 49 Units in Stock
Ask a question


Add to Cart:

pLP2

PVT2325     2ug

 

pLP2 Information

Promoter: RSV

Replicator: pUC ori, F1 ori

Plasmid classification: virus series, lentivirus packaging carrier

Plasmid size: 4180bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: M13F:TGTAAAACGACGGCCAGT

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pLP2 Description

 

pLP2


pLP2 Publication

FOXO3a‑SIRT6 axis suppresses aerobic glycolysis in melanoma

International Journal of Oncology
Authors: Zhen Dong Jie Yang Lin Li Li Tan Pengfei Shi Jiayi Zhang Xi Zhong Lingjun Ge Zonghui Wu Hongjuan Cui
Published online on: January 17, 2020     https://doi.org/10.3892/ijo.2020.4964
Pages: 728-742

 

pLP2 Sequence

LOCUS       Exported                4180 bp ds-DNA     circular SYN 27-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 33

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4180)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Saturday, August 27, 2016 from SnapGene Viewer 3.1.4

           

FEATURES             Location/Qualifiers

     source          1..4180

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        1..262

                     /note="RSV promoter"

                     /note="Rous sarcoma virus enhancer/promoter"

     primer_bind     complement(825..841)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     rep_origin      1173..1628

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        1910..2014

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             2015..2875

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      3046..3634

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     protein_bind    3922..3943

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        3958..3988

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    3996..4012

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     4020..4036

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 aatgtagtct tatgcaatac tcttgtagtc ttgcaacatg gtaacgatga gttagcaaca

       61 tgccttacaa ggagagaaaa agcaccgtgc atgccgattg gtggaagtaa ggtggtacga

      121 tcgtgcctta ttaggaaggc aacagacggg tctgacatgg attggacgaa ccactgaatt

      181 ccgcattgca gagatattgt atttaagtgc ctagctcgat acaataaacg ccatttgacc

      241 attcaccaca ttggtgtgca cctccaagct cgagctcgtt tagtgaaccg tcagatcgcc

      301 tggagacgcc atccacgctg ttttgacctc catagaagac accgggaccg atccagcctc

      361 ccctcgaagc tagtcgatta ggcatctcct atggcaggaa gaagcggaga cagcgacgaa

      421 gacctcctca aggcagtcag actcatcaag tttctctatc aaagcaaccc acctcccaat

      481 cccgagggga cccgacaggc ccgaaggaat agaagaagaa ggtggagaga gagacagaga

      541 cagatccatt cgattagtga acggatcctt agcacttatc tgggacgatc tgcggagcct

      601 gtgcctcttc agctaccacc gcttgagaga cttactcttg attgtaacga ggattgtgga

      661 acttctggga cgcagggggt gggaagccct caaatattgg tggaatctcc tacaatattg

      721 gagtcaggag ctaaagaata gtgctgttag cttgctcaat gccacagcta tagcagtagc

      781 tgaggggaca gatagggtta tagaagtagt acaagaagct tggcactggc cgtcgtttta

      841 caacgtcgtg atctgagcct gggagatctc tggctaacta gggaacccac tgcttaagcc

      901 tcaataaagc ttgccttgag tgcttcaagt agtgtgtgcc cgtctgttgt gtgactctgg

      961 taactagaga tcaggaaaac cctggcgtta cccaacttaa tcgccttgca gcacatcccc

     1021 ctttcgccag ctggcgtaat agcgaagagg cccgcaccga tcgcccttcc caacagttgc

     1081 gcagcctgaa tggcgaatgg cgcctgatgc ggtattttct ccttacgcat ctgtgcggta

     1141 tttcacaccg catacgtcaa agcaaccata gtacgcgccc tgtagcggcg cattaagcgc

     1201 ggcgggtgtg gtggttacgc gcagcgtgac cgctacactt gccagcgccc tagcgcccgc

     1261 tcctttcgct ttcttccctt cctttctcgc cacgttcgcc ggctttcccc gtcaagctct

     1321 aaatcggggg ctccctttag ggttccgatt tagtgcttta cggcacctcg accccaaaaa

     1381 acttgatttg ggtgatggtt cacgtagtgg gccatcgccc tgatagacgg tttttcgccc

     1441 tttgacgttg gagtccacgt tctttaatag tggactcttg ttccaaactg gaacaacact

     1501 caaccctatc tcgggctatt cttttgattt ataagggatt ttgccgattt cggcctattg

     1561 gttaaaaaat gagctgattt aacaaaaatt taacgcgaat tttaacaaaa tattaacgtt

     1621 tacaatttta tggtgcactc tcagtacaat ctgctctgat gccgcatagt taagccagcc

     1681 ccgacacccg ccaacacccg ctgacgcgcc ctgacgggct tgtctgctcc cggcatccgc

     1741 ttacagacaa gctgtgaccg tctccgggag ctgcatgtgt cagaggtttt caccgtcatc

     1801 accgaaacgc gcgagacgaa agggcctcgt gatacgccta tttttatagg ttaatgtcat

     1861 gataataatg gtttcttaga cgtcaggtgg cacttttcgg ggaaatgtgc gcggaacccc

     1921 tatttgttta tttttctaaa tacattcaaa tatgtatccg ctcatgagac aataaccctg

     1981 ataaatgctt caataatatt gaaaaaggaa gagtatgagt attcaacatt tccgtgtcgc

     2041 ccttattccc ttttttgcgg cattttgcct tcctgttttt gctcacccag aaacgctggt

     2101 gaaagtaaaa gatgctgaag atcagttggg tgcacgagtg ggttacatcg aactggatct

     2161 caacagcggt aagatccttg agagttttcg ccccgaagaa cgttttccaa tgatgagcac

     2221 ttttaaagtt ctgctatgtg gcgcggtatt atcccgtatt gacgccgggc aagagcaact

     2281 cggtcgccgc atacactatt ctcagaatga cttggttgag tactcaccag tcacagaaaa

     2341 gcatcttacg gatggcatga cagtaagaga attatgcagt gctgccataa ccatgagtga

     2401 taacactgcg gccaacttac ttctgacaac gatcggagga ccgaaggagc taaccgcttt

     2461 tttgcacaac atgggggatc atgtaactcg ccttgatcgt tgggaaccgg agctgaatga

     2521 agccatacca aacgacgagc gtgacaccac gatgcctgta gcaatggcaa caacgttgcg

     2581 caaactatta actggcgaac tacttactct agcttcccgg caacaattaa tagactggat

     2641 ggaggcggat aaagttgcag gaccacttct gcgctcggcc cttccggctg gctggtttat

     2701 tgctgataaa tctggagccg gtgagcgtgg gtctcgcggt atcattgcag cactggggcc

     2761 agatggtaag ccctcccgta tcgtagttat ctacacgacg gggagtcagg caactatgga

     2821 tgaacgaaat agacagatcg ctgagatagg tgcctcactg attaagcatt ggtaactgtc

     2881 agaccaagtt tactcatata tactttagat tgatttaaaa cttcattttt aatttaaaag

     2941 gatctaggtg aagatccttt ttgataatct catgaccaaa atcccttaac gtgagttttc

     3001 gttccactga gcgtcagacc ccgtagaaaa gatcaaagga tcttcttgag atcctttttt

     3061 tctgcgcgta atctgctgct tgcaaacaaa aaaaccaccg ctaccagcgg tggtttgttt

     3121 gccggatcaa gagctaccaa ctctttttcc gaaggtaact ggcttcagca gagcgcagat

     3181 accaaatact gttcttctag tgtagccgta gttaggccac cacttcaaga actctgtagc

     3241 accgcctaca tacctcgctc tgctaatcct gttaccagtg gctgctgcca gtggcgataa

     3301 gtcgtgtctt accgggttgg actcaagacg atagttaccg gataaggcgc agcggtcggg

     3361 ctgaacgggg ggttcgtgca cacagcccag cttggagcga acgacctaca ccgaactgag

     3421 atacctacag cgtgagctat gagaaagcgc cacgcttccc gaagggagaa aggcggacag

     3481 gtatccggta agcggcaggg tcggaacagg agagcgcacg agggagcttc cagggggaaa

     3541 cgcctggtat ctttatagtc ctgtcgggtt tcgccacctc tgacttgagc gtcgattttt

     3601 gtgatgctcg tcaggggggc ggagcctatg gaaaaacgcc agcaacgcgg cctttttacg

     3661 gttcctggcc ttttgctggc cttttgctca catgttcttt cctgcgttat cccctgattc

     3721 tgtggataac cgtattaccg cctttgagtg agctgatacc gctcgccgca gccgaacgac

     3781 cgagcgcagc gagtcagtga gcgaggaagc ggaagagcgc ccaatacgca aaccgcctct

     3841 ccccgcgcgt tggccgattc attaatgcag ctggcacgac aggtttcccg actggaaagc

     3901 gggcagtgag cgcaacgcaa ttaatgtgag ttagctcact cattaggcac cccaggcttt

     3961 acactttatg cttccggctc gtatgttgtg tggaattgtg agcggataac aatttcacac

     4021 aggaaacagc tatgacatga ttacgaattc gatgtacggg ccagatatac gcgtatctga

     4081 ggggactagg gtgtgtttag gcgaaaagcg gggcttcggt tgtacgcggt taggagtccc

     4141 ctcaggatat agtagtttcg cttttgcata gggaggggga

//
 

Caution:
Product is for research use only!

 


Search name

pLP2,Plasmid pLP2,pLP2 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart