pLpp- OmpA Plasmid

$162.00

  • Model: PVT0376
  • 50 Units in Stock
Ask a question


Add to Cart:

pLpp-OmpA

Search name

pLpp-OmpA,Plasmid pLpp-OmpA,pLpp-OmpA vector

pLpp-OmpA plasmid information

Promoter: lpp/lac
Replicon: ColE1 ori
Plasmid classification: Escherichia coli vector; PET series expression plasmid
Plasmid size: 7533bp
Plasmid label: N-OmpA, C-6 x His
Prokaryotic resistance: ampicillin Amp
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: BL21 (DE3)
Culture conditions: 37 centigrade, aerobic, LB
Inducement: IPTG or lactose and its analogues
5'sequencing primers: 5 GGC TTT ACA CTT TAT GCT TC 3
3'sequencing primers: 5CCA TTT TTC ACT TCA CAG G 3

pLpp-OmpA plasmid Description

pLpp-OmpA-Plasmid

pLpp-OmpA plasmid Sequence

LOCUS       Exported                7533 bp ds-DNA     circular SYN 28-JUL-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pLpp-OmpA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7533)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Tuesday, September 6, 2016 from SnapGene Viewer 3.1.4
            
FEATURES             Location/Qualifiers
     source          1..7533
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        247..277
                     /note="lac UV5 promoter"
                     /note="E. coli lac promoter with an ""up"" mutation"
     protein_bind    285..301
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     309..325
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             458..475
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /note="6xHis"
                     /translation="HHHHHH"
     promoter        1840..1917
                     /gene="lacI"
                     /note="lacI promoter"
     CDS             1918..3000
                     /codon_start=1
                     /gene="lacI"
                     /product="lac repressor"
                     /note="lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
                     ALADSLMQLARQVSRLESGQ"
     protein_bind    3013..3034
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     CDS             5099..5290
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /note="rop"
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     misc_feature    5392..5532
                     /note="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(5718..6306)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(6477..7337)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(7338..7442)
                     /gene="bla"
                     /note="AmpR promoter"
ORIGIN
        1 ggataaccag aagcaataaa aaatcaaatc ggatttcact atataatctc actttatcta
       61 agatgaatcc gatggaagca tcctgttttc tctcaatttt tttatctaaa acccagcgtt
      121 cgatgcttct ttgagcgaac gatcaaaaat aagtgccttc ccatcaaaaa aatattctca
      181 acataaaaaa ctttgtgtaa tacttgtaac gctacatgga gattaactca atctagctag
      241 agaggcttta cactttatgc ttccggctcg tataatgtgt ggaattgtga gcggataaca
      301 atttcacaca ggaaacagct atgaccatga ttacggattc actggaactc tagataacga
      361 ggcgcaaaaa atgaaaaaga cagctatcgc gattgcagtg

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart