pLTR- RD114A

$160.00

  • Model: PVT11102
  • 50 Units in Stock
Ask a question


Add to Cart:

pLTR-RD114A


Catalog No. PVT11102
Packing 2ug

 

pLTR-RD114A Information

Prokaryotic resistance: kanamycin Kan

Screening markers: Mycophenolate G418

Cloned strain: Escherichia coli Stbl3

Culture conditions: 37 degrees centigrade

 

pLTR-RD114A Description

PLTR-RD114A lentiviral RD114 envelope protein was used to express the packaging plasmid.

 

pLTR-RD114A Sequence

 

LOCUS       Exported                6258 bp ds-DNA     circular SYN 03-NOV-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..6258
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     polyA_signal    3046..3167
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(3174..3629)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        3656..3760
                     /gene="bla"
                     /label=AmpR promoter
     promoter        3762..4119
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      3970..4105
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     CDS             4154..4948
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    5180..5227
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      5556..6144
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 tagttattac cggactcaga tctcgagacc tagaaaaaca tggagcaatc acaagtagca
       61 atacagcagc taacaatgct gcttgtgcct ggctagaagc acaagaggag gaagaggtgg
      121 gttttccagt cacacctcag gtacctttaa gaccaatgac ttacaaggca gctgtagatc
      181 ttagccactt tttaaaagaa aaggggggac tggaagggct aattcactcc caaagaagac
      241 aagatatcct tgatctgtgg atctaccaca cacaaggcta cttccctgat tggcagaact
      301 acacaccagg gccaggggtc agatatccac tgacctttgg atggtgctac aagctagtac
      361 cagttgagcc agataaggta gaagaggcca ataaaggaga gaacaccagc ttgttacacc
      421 ctgtgagcct gcatggaatg gatgaccctg agagagaagt gttagagtgg aggtttgaca
      481 gccgcctagc atttcatcac gtggcccgag agctgcatcc ggagtacttc aagaactgct
      541 gacatcgagc ttgctacaag ggactttccg ctggggactt tccagggagg cgtggcctgg
      601 gcgggactgg ggagtggcga gccctcagat gctgcatata agcagctgct ttttgcctgt
      661 actgggtctc tctggttaga ccagatctga gcctgggagc tctctggcta actagggaac
      721 ccactgctta agcctcaata aagctgatcc cccgggctgc aggaatttat gaaatccttt
      781 atgggggacc cccccctttg tcaaccttgc tcaattcctt ctccccctcc gatcctaaga
      841 ctgatttaca agcccgacta aaagggctgc aaggcgtgca ggcccaaatc tggacacccc
      901 tggccgaatt gtaccggcca ggacatccac aaactagcca cccatttcag gtgggagact
      961 ccgtgtacgt ccggcggcac cgctctcaag gattggagcc tcgttggaag ggaccttaca
     1021 tcgtcctgct gaccacgccc accgccataa aggttgacgg gatcgccgcc tggattcacg
     1081 catcgcacgc caaggcagcc ccaaaaaccc ctggaccaga aactcccaaa acctggaagc
     1141 tccgccgttc ggagaaccct cttaagataa gactctcccg tgtctgactg ctaatccacc
     1201 ttgtccctgt actaacccaa aatgaaactc ccaacaggaa tggtcatttt atgtagccta
     1261 ataatagttc gggcagggtt tgacgacccc cgcaaggcta tcgcattagt acaaaaacaa
     1321 catggtaaac catgcgaatg cagcggaggg caggtatccg aggccccacc gaactccatc
     1381 caacaggtaa cttgcccagg caagacggcc tacttaatga ccaaccaaaa atggaaatgc
     1441 agagtcactc caaaaaatct cacccctagc gggggagaac tccagaactg cccctgtaac
     1501 actttccagg actcgatgca cagttcttgt tatactgaat accggcaatg cagggcgaat
     1561 aataagacat actacacggc caccttgctt aaaatacggt ctgggagcct caacgaggta
     1621 cagatattac aaaaccccaa tcagctccta cagtcccctt gtaggggctc tataaatcag
     1681 cccgtttgct ggagtgccac agcccccatc catatctccg atggtggagg acccctcgat
     1741 actaagagag tgtggacagt ccaaaaaagg ctagaacaaa ttcataaggc tatgcatcct
     1801 gaacttcaat accacccctt agccctgccc aaagtcagag atgaccttag ccttgatgca
     1861 cggacttttg atatcctgaa taccactttt aggttactcc agatgtccaa ttttagcctt
     1921 gcccaagatt gttggctctg tttaaaacta ggtaccccta cccctcttgc gatacccact
     1981 ccctctttaa cctactccct agcagactcc ctagcgaatg cctcctgtca gattatacct
     2041 cccctcttgg ttcaaccgat gcagttctcc aactcgtcct gtttatcttc ccctttcatt
     2101 aacgatacgg aacaaataga cttaggtgca gtcaccttta ctaactgcac ctctgtagcc
     2161 aatgtcagta gtcctttatg tgccctaaac gggtcagtct tcctctgtgg aaataacatg
     2221 gcatacacct atttacccca aaactggaca ggactttgcg tccaagcctc cctcctcccc
     2281 gacattgaca tcatcccggg ggatgagcca gtccccattc ctgccattga tcattatata
     2341 catagaccta aacgagctgt acagttcatc cctttactag ctggactggg aatcaccgca
     2401 gcattcacca ccggagctac aggcctaggt gtctccgtca cccagtatac aaaattatcc
     2461 catcagttaa tatctgatgt ccaagtctta tccggtacca tacaagattt acaagaccag
     2521 gtagactcgt tagctgaagt agttctccaa aataggaggg gactggacct actaacggca
     2581 gaacaaggag gaatttgttt agccttacaa gaaaaatgct gtttttatgc taacaagtca
     2641 ggaattgtga gaaacaaaat aagaacccta caagaagaat tacaaaaacg cagggaaagc
     2701 ctggcatcca accctctctg gaccgggctg cagggctttc ttccgtacct cctacctctc
     2761 ctgggacccc tactcaccct cctactcata ctaaccattg ggccatgcgt tttcaatcga
     2821 ttggtccaat ttgttaaaga caggatctca gtggtccagg ctctggtttt gactcagcaa
     2881 tatcaccagc taaaacccat agagtacgag ccatgaagat ccaccggatc tagataactg
     2941 atcataatca gccataccac atttgtagag gttttacttg ctttaaaaaa cctcccacac
     3001 ctccccctga acctgaaaca taaaatgaat gcaattgttg ttgttaactt gtttattgca
     3061 gcttataatg gttacaaata aagcaatagc atcacaaatt tcacaaataa agcatttttt
     3121 tcactgcatt ctagttgtgg tttgtccaaa ctcatcaatg tatcttaacg cgtaaattgt
     3181 aagcgttaat attttgttaa aattcgcgtt aaatttttgt taaatcagct cattttttaa
     3241 ccaataggcc gaaatcggca aaatccctta taaatcaaaa gaatagaccg agatagggtt
     3301 gagtgttgtt ccagtttgga acaagagtcc actattaaag aacgtggact ccaacgtcaa
     3361 agggcgaaaa accgtctatc agggcgatgg cccactacgt gaaccatcac cctaatcaag
     3421 ttttttgggg tcgaggtgcc gtaaagcact aaatcggaac cctaaaggga gcccccgatt
     3481 tagagcttga cggggaaagc cggcgaacgt ggcgagaaag gaagggaaga aagcgaaagg
     3541 agcgggcgct agggcgctgg caagtgtagc ggtcacgctg cgcgtaacca ccacacccgc
     3601 cgcgcttaat gcgccgctac agggcgcgtc aggtggcact tttcggggaa atgtgcgcgg
     3661 aacccctatt tgtttatttt tctaaataca ttcaaatatg tatccgctca tgagacaata
     3721 accctgataa atgcttcaat aatattgaaa aaggaagagt cctgaggcgg aaagaaccag
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart