pLVTHM

$215.00

  • Model: PVT11115
  • 50 Units in Stock
Ask a question


Add to Cart:

pLVTHM


Catalog No. PVT11115
Packing 2ug

 

pLVTHM Information

Promoter: EF-1 alpha, H1, SV40

Replicator: pUC ori, SV40 ori

Terminator: SV40 poly (A) signal, bGH poly (A) signal

Plasmid classification: virus series, lentivirus interference carrier

Plasmid size: 11085bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: primers designed according to sequence

3'sequencing primers: WPRE-R:CATAGCGTAAAAGGAGCAACA

 

pLVTHM Description

pLVTHM allows for direct cloning of shRNAs into the lentiviral vectors and replaces the old pLVTH system from Trono lab. pLVTHM is similar to pLVTH, but contains a 3bp substitution that generates a unique MluI site for direct cloning of an shRNA into MluI-ClaI. Please note that there is an additional ClaI site in this vector that is blocked by Dam methylation . The plasmid needs to be grown in a Dam+ bacterial strain in order to use ClaI for cloning. Note that ClaI has lower salt concentration requirements than MluI. One way to handle this is to digest with ClaI for 45 minutes, followed by addition of diluted MluI buffer and MluI, then incubation for 90 more minutes. Be sure not to use a large amount of vector (1.7 ug to 2.5 ug is known to work). Also, if your shRNA is already in pSUPER (or another plasmid under the control of the PolIII promoter) you may use the EcoRI-ClaI sites to replace the H1 promoter in pLVTHM with the H1-shRNA cassette from pSUPER (or another plasmid).

pLVTHM-vector

 

pLVTHM Sequence

LOCUS       Exported               11085 bp ds-DNA     circular SYN 09-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 3

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 11085)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Friday, September 9, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..11085

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     polyA_signal    168..302

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     CDS             complement(727..747)

                     /codon_start=1

                     /product="nuclear localization signal of SV40 large T 

                     antigen"

                     /note="SV40 NLS"

                     /translation="PKKKRKV"

     intron          877..942

                     /note="small t intron"

                     /note="simian virus 40 (SV40) small t antigen intron"

     promoter        complement(2076..2405)

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      2090..2225

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     rep_origin      complement(2651..3239)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(3410..4270)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(4271..4375)

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        5163..5181

                     /note="SP6 promoter"

                     /note="promoter for bacteriophage SP6 RNA polymerase"

     LTR             5206..5386

                     /note="5' LTR (truncated)"

                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"

     protein_bind    complement(5406..5439)

                     /bound_moiety="Cre recombinase"

                     /note="loxP"

                     /note="Cre-mediated recombination occurs in the 8-bp core 

                     sequence (GCATACAT)."

     promoter        complement(5474..5688)

                     /note="H1 promoter"

                     /note="human H1 RNA promoter"

     protein_bind    5717..5987

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tetracycline response element"

                     /note="contains seven copies of the tetracycline operator 

                     tetO"

     misc_feature    6155..6743

                     /note="WPRE"

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     CDS             6261..6272

                     /codon_start=1

                     /product="Factor Xa recognition and cleavage site"

                     /note="Factor Xa site"

                     /translation="IEGR"

     CDS             complement(6816..7532)

                     /codon_start=1

                     /product="enhanced GFP"

                     /note="EGFP"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     misc_feature    7622..7739

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1"

     promoter        complement(7787..8964)

                     /note="EF-1-alpha promoter"

                     /note="strong constitutive promoter for human elongation 

                     factor EF-1-alpha"

     intron          7796..8733

                     /note="EF-1-alpha intron A"

                     /note="intron upstream of the start codon of human 

                     EF-1-alpha"

     misc_feature    9553..9786

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    10279..10404

                     /note="HIV-1 Psi"

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     LTR             10451..11084

                     /note="3' LTR"

                     /note="3' long terminal repeat (LTR) from HIV-1"

ORIGIN

        1 ctactaagtt tgtagtacat atttaacaaa tacaatttct ttaaaatgaa aataattcag

       61 aggaatcaca ggtttagagt aaatgaaacc actaggtaat tggcagtggt aatagggtat

      121 ggggtgggaa gtttgggatg attttggtta gcttgagtta tccagttgat ccagacatga

      181 taagatacat tgatgagttt ggacaaacca caactagaat gcagtgaaaa aaatgcttta

      241 tttgtgaaat ttgtgatgct attgctttat ttgtaaccat tataagctgc aataaacaag

      301 ttaacaacaa caattgcatt cattttatgt ttcaggttca gggggaggtg tgggaggttt

      361 tttaaagcaa gtaaaacctc tacaaatgtg gtatggctga ttatgatctc tagtcaaggc

      421 actatacatc aaatattcct tattaacccc tttacaaatt aaaaagctaa aggtacacaa

      481 tttttgagca tagttattaa tagcagacac tctatgcctg tgtggagtaa gaaaaaacag

      541 tatgttatga ttataactgt tatgcctact tataaaggtt acagaatatt tttccataat

      601 tttcttgtat agcagtgcag ctttttcctt tgtggtgtaa atagcaaagc aagcaagagt

      661 tctattacta aacacagcat gactcaaaaa acttagcaat tctgaaggaa agtccttggg

      721 gtcttctacc tttctcttct tttttggagg agtagaatgt tgagagtcag cagtagcctc

      781 atcatcacta gatggcattt cttctgagca aaacaggttt tcctcattaa aggcattcca

      841 ccactgctcc cattcatcag ttccataggt tggaatctaa aatacacaaa caattagaat

      901 cagtagttta acacattata cacttaaaaa ttttatattt accttagagc tttaaatctc

      961 tgtaggtagt ttgtccaatt atgtcacacc acagaagtaa ggttccttca caaagatccg

     1021 gggcccactc ataaatccag ttgccgccac ggtagccaat caccgtatcg tataaatcat

     1081 cgtcggtacg ttcggcatcg ctcatcacaa tacgtgcctg gacgtcgagg atttcgcgtg

     1141 ggtcaatgcc gcgccagatc cacatcagac ggttaatcat gcgataccag tgagggatgg

     1201 ttttaccatc aagggccgac tgcacaggcg gttgtgcgcc gtgattaaag cggcggacta

     1261 gcgtcgaggt ttcaggatgt ttaaagcggg gtttgaacag ggtttcgctc aggtttgcct

     1321 gtgtcatgga tgcagcctcc agaatactta ctggaaacta ttgtaacccg cctgaagtta

     1381 aaaagaacaa cgcccggcag tgccaggcgt tgaaaagatt agcgaccgga gattggcggg

     1441 acgaatacga cgcccatatc ccacggctgt tcaatccagg tatcttgcgg gatatcaaca

     1501 acatagtcat caaccagcgg acgaccagcc ggttttgcga agatggtgac aaagtgcgct

     1561 tttggataca tttcacgaat cgcaaccgca gtaccaccgg tatccaccag gtcatcaata

     1621 acgatgaagc cttcgccatc gccttctgcg cgtttcagca ctttaagctc gcgctggttg

     1681 tcgtgatcgt agctggaaat acaaacggta tcgacatgac gaatacccag ttcacgcgcc

     1741 agtaacgcac ccggtacaga ccgccacggc ttacggcaat aatgcctttc cattgttcag

     1801 aaggcatcag tcggcttgcg agtttacgtg catggatctg caacatgtcc caggtgacga

     1861 tgtatttttc gctcatgtga agtgtcccag cctgtttatc tacggcttaa aaagtgttcg

     1921 aggggaaaat aggttgcgcg agattataga gatctggcgc actaaaaacc agtatttcac

     1981 atgagtccgc gtctttttac gcactgcctc tccctgacgc gggataaagt ggtattctca

     2041 aacatatctc gcaagcctgt cttgtgtcca agctttttgc aaaagcctag gcctccaaaa

     2101 aagcctcctc actacttctg gaatagctca gaggccgagg cggcctcggc ctctgcataa

     2161 ataaaaaaaa ttagtcagcc atggggcgga gaatgggcgg aactgggcgg agttaggggc

     2221 gggatgggcg gagttagggg cgggactatg gttgctgact aattgagatg catgctttgc

     2281 atacttctgc ctgctgggga gcctggggac tttccacacc tggttgctga ctaattgaga

     2341 tgcatgcttt gcatacttct gcctgctggg gagcctgggg actttccaca ccctaactga

     2401 cacacattcc acagctgcat taatgaatcg gccaacgcgc ggggagaggc ggtttgcgta

     2461 ttgggcgctc ttccgcttcc tcgctcactg actcgctgcg ctcggtcgtt cggctgcggc

     2521 gagcggtatc agctcactca aaggcggtaa tacggttatc cacagaatca ggggataacg

     2581 caggaaagaa catgtgagca aaaggccagc aaaaggccag gaaccgtaaa aaggccgcgt

     2641 tgctggcgtt tttccatagg ctccgccccc ctgacgagca tcacaaaaat cgacgctcaa

     2701 gtcagaggtg gcgaaacccg acaggactat aaagatacca ggcgtttccc cctggaagct

     2761 ccctcgtgcg ctctcctgtt ccgaccctgc cgcttaccgg atacctgtcc gcctttctcc

     2821 cttcgggaag cgtggcgctt tctcaatgct cacgctgtag gtatctcagt tcggtgtagg

     2881 tcgttcgctc caagctgggc tgtgtgcacg aaccccccgt tcagcccgac cgctgcgcct

     2941 tatccggtaa ctatcgtctt gagtccaacc cggtaagaca cgacttatcg ccactggcag

     3001 cagccactgg taacaggatt agcagagcga ggtatgtagg cggtgctaca gagttcttga

     3061 agtggtggcc taactacggc tacactagaa ggacagtatt tggtatctgc gctctgctga

     3121 agccagttac cttcggaaaa agagttggta gctcttgatc cggcaaacaa accaccgctg

     3181 gtagcggtgg tttttttgtt tgcaagcagc agattacgcg cagaaaaaaa ggatctcaag

     3241 aagatccttt gatcttttct acggggtctg acgctcagtg gaacgaaaac tcacgttaag

     3301 ggattttggt catgagatta tcaaaaagga tcttcaccta gatcctttta aattaaaaat

     3361 gaagttttaa atcaatctaa agtatatatg agtaaacttg gtctgacagt taccaatgct

     3421 taatcagtga ggcacctatc tcagcgatct gtctatttcg ttcatccata gttgcctgac

     3481 tccccgtcgt gtagataact acgatacggg agggcttacc atctggcccc agtgctgcaa

     3541 tgataccgcg agacccacgc tcaccggctc cagatttatc agcaataaac cagccagccg

     3601 gaagggccga gcgcagaagt ggtcctgcaa ctttatccgc ctccatccag tctattaatt

     3661 gttgccggga agctagagta agtagttcgc cagttaatag tttgcgcaac gttgttgcca

     3721 ttgctacagg catcgtggtg tcacgctcgt cgtttggtat ggcttcattc agctccggtt

     3781 cccaacgatc aaggcgagtt acatgatccc ccatgttgtg caaaaaagcg gttagctcct

     3841 tcggtcctcc gatcgttgtc agaagtaagt tggccgcagt gttatcactc atggttatgg

     3901 cagcactgca taattctctt actgtcatgc catccgtaag atgcttttct gtgactggtg

     3961 agtactcaac caagtcattc tgagaatagt gtatgcggcg accgagttgc tcttgcccgg

     4021 cgtcaatacg ggataatacc gcgccacata gcagaacttt aaaagtgctc atcattggaa

     4081 aacgttcttc ggggcgaaaa ctctcaagga tcttaccgct gttgagatcc agttcgatgt

     4141 aacccactcg tgcacccaac tgatcttcag catcttttac tttcaccagc gtttctgggt

     4201 gagcaaaaac aggaaggcaa aatgccgcaa aaaagggaat aagggcgaca cggaaatgtt

     4261 gaatactcat actcttcctt tttcaatatt attgaagcat ttatcagggt tattgtctca

     4321 tgagcggata catatttgaa tgtatttaga aaaataaaca aataggggtt ccgcgcacat

     4381 ttccccgaaa agtgccacct gacgtctaag aaaccattat tatcatgaca ttaacctata

     4441 aaaataggcg tatcacgagg ccctttcgtc tcgcgcgttt cggtgatgac ggtgaaaacc

     4501 tctgacacat gcagctcccg gagacggtca cagcttgtct gtaagcggat gccgggagca

     4561 gacaagcccg tcagggcgcg tcagcgggtg ttggcgggtg tcggggctgg cttaactatg

     4621 cggcatcaga gcagattgta ctgagagtgc accattcgac gctctccctt atgcgactcc

     4681 tgcattagga agcagcccag tagtaggttg aggccgttga gcaccgccgc cgcaaggaat

     4741 ggtgcatgca aggagatggc gcccaacagt cccccggcca cggggcctgc caccataccc

     4801 acgccgaaac aagcgctcat gagcccgaag tggcgagccc gatcttcccc atcggtgatg

     4861 tcggcgatat aggcgccagc aaccgcacct gtggcgccgg tgatgccggc cacgatgcgt

     4921 ccggcgtaga ggatctggct agcgatgacc ctgctgattg gttcgctgac catttccggg

     4981 tgcgggacgg cgttaccaga aactcagaag gttcgtccaa ccaaaccgac tctgacggca

     5041 gtttacgaga gagatgatag ggtctgcttc agtaagccag atgctacaca attaggcttg

     5101 tacatattgt cgttagaacg cggctacaat taatacataa ccttatgtat catacacata

     5161 cgatttaggt gacactatag aatacacgga attaattcta gatgctgcta gagattttcc

     5221 acactgacta aaagggtctg agggatctct agttaccaga gtcacacaac agacgggcac

     5281 acactacttg aagcactcaa ggcaagcttt attgaggctt aagcagtggg ttccctagtt

     5341 agccagagag ctcccaggct cagatctggt ctaaccagag agacccagta caagcaaaaa

     5401 gcagcataac ttcgtataat gtatgctata cgaagttatt cccatgcgac ggtatcgata

     5461 agcttggaga cgcgtggtct catacagaac ttataagatt cccaaatcca aagacatttc

     5521 acgtttatgg tgatttccca gaacacatag cgacatgcaa atattgcagg gcgccactcc

     5581 cctgtccctc acagccatct tcctgccagg gcgcacgcgc gctgggtgtt cccgcctagt

     5641 gacactgggc ccgcgattcc ttggagcggg ttgatgacgt cagcgttcga attcctgcag

     5701 ccccgacttt cacttttctc tatcactgat agggagtggt aaactcgact ttcacttttc

     5761 tctatcactg atagggagtg gtaaactcga ctttcacttt tctctatcac tgatagggag

     5821 tggtaaactc gactttcact tttctctatc actgataggg agtggtaaac tcgactttca

     5881 cttttctcta tcactgatag ggagtggtaa actcgacttt cacttttctc tatcactgat

     5941 agggagtggt aaactcgact ttcacttttc tctatcactg atagggagtg gtaaactcga

     6001 gggggatcca ctagcatggt gaattgatcc catcttgtct tcgttgggag tgaattagcc

     6061 cttccagtcc ccccttttct tttaaaaagt ggctaagatc tacagctgcc ttgtaagtca

     6121 ttggtcttaa aggtacctgg ccatacgtac cgatgcgggg aggcggccca aagggagatc

     6181 cgactcgtct gagggcgaag gcgaagacgc ggaagaggcc gcagagccgg cagcaggccg

     6241 cgggaaggaa ggtccgctgg attgagggcc gaagggacgt agcagaagga cgtcccgcgc

     6301 agaatccagg tggcaacaca ggcgagcagc catggaaagg acgtcagctt ccccgacaac

     6361 accacggaat tgtcagtgcc caacagccga gcccctgtcc agcagcgggc aaggcaggcg

     6421 gcgatgagtt ccgccgtggc aatagggagg gggaaagcga aagtcccgga aaggagctga

     6481 caggtggtgg caatgcccca accagtgggg gttgcgtcag caaacacagt gcacaccacg

     6541 ccacgttgcc tgacaacggg ccacaactcc tcataaagag acagcaacca ggatttatac

     6601 aaggaggaga aaatgaaagc catacgggaa gcaatagcat gatacaaagg cattaaagca

     6661 gcgtatccac atagcgtaaa aggagcaaca tagttaagaa taccagtcaa tctttcacaa

     6721 attttgtaat ccagaggttg attatcatat gactagtccc cgaagttgag ctcgactagc

     6781 tagctagcta ctagctatcg agatctgagt ccggacttgt acagctcgtc catgccgaga

     6841 gtgatcccgg cggcggtcac gaactccagc aggaccatgt gatcgcgctt ctcgttgggg

     6901 tctttgctca gggcggactg ggtgctcagg tagtggttgt cgggcagcag cacggggccg

     6961 tcgccgatgg gggtgttctg ctggtagtgg tcggcgagct gcacgctgcc gtcctcgatg

     7021 ttgtggcgga tcttgaagtt caccttgatg ccgttcttct gcttgtcggc catgatatag

     7081 acgttgtggc tgttgtagtt gtactccagc ttgtgcccca ggatgttgcc gtcctccttg

     7141 aagtcgatgc ccttcagctc gatgcggttc accagggtgt cgccctcgaa cttcacctcg

     7201 gcgcgggtct tgtagttgcc gtcgtccttg aagaagatgg tgcgctcctg gacgtagcct

     7261 tcgggcatgg cggacttgaa gaagtcgtgc tgcttcatgt ggtcggggta gcggctgaag

     7321 cactgcacgc cgtaggtcag ggtggtcacg agggtgggcc agggcacggg cagcttgccg

     7381 gtggtgcaga tgaacttcag ggtcagcttg ccgtaggtgg catcgccctc gccctcgccg

     7441 gacacgctga acttgtggcc gtttacgtcg ccgtccagct cgaccaggat gggcaccacc

     7501 ccggtgaaca gctcctcgcc cttgctcacc atggtggcga ccggtagcgc taggacgcgc

     7561 gcgtaagctt aggccttcga agatcccgta gtttaaacct cgaggctagt ctcgtgatcg

     7621 gaaaattttg aatttttgta atttgttttt gtaattcttt agtttgtatg tctgttgcta

     7681 ttatgtctac tattctttcc cctgcactgt accccccaat cccccctttt cttttaaaag

     7741 ttaaccgata ccgtcgagat taattaaatt taaatgtcga aattcctcac gacacctgaa

     7801 atggaagaaa aaaactttga accactgtct gaggcttgag aatgaaccaa gatccaaact

     7861 caaaaagggc aaattccaag gagaattaca tcaagtgcca agctggccta acttcagtct

     7921 ccacccactc agtgtgggga aactccatcg cataaaaccc ctccccccaa cctaaagacg

     7981 acgtactcca aaagctcgag aactaatcga ggtgcctgga cggcgcccgg tactccgtgg

     8041 agtcacatga agcgacggct gaggacggaa aggccctttt cctttgtgtg ggtgactcac

     8101 ccgcccgctc tcccgagcgc cgcgtcctcc attttgagct ccctgcagca gggccgggaa

     8161 gcggccatct ttccgctcac gcaactggtg ccgaccgggc cagccttgcc gcccagggcg

     8221 gggcgataca cggcggcgcg aggccaggca ccagagcagg ccggccagct tgagactacc

     8281 cccgtccgat tctcggtggc cgcgctcgca ggccccgcct cgccgaacat gtgcgctggg

     8341 acgcacgggc cccgtcgccg cccgcggccc caaaaaccga aataccagtg tgcagatctt

     8401 ggcccgcatt tacaagacta tcttgccaga aaaaaagcgt cgcagcaggt catcaaaaat

     8461 tttaaatggc tagagactta tcgaaagcag cgagacaggc gcgaaggtgc caccagattc

     8521 gcacgcggcg gccccagcgc ccaggccagg cctcaactca agcacgaggc gaaggggctc

     8581 cttaagcgca aggcctcgaa ctctcccacc cacttccaac ccgaagctcg ggatcaagaa

     8641 tcacgtactg cagccagtgg aagtaattca aggcacgcaa gggccataac ccgtaaagag

     8701 gccaggcccg cgggaaccac acacggcact tacctgtgtt ctggcggcaa acccgttgcg

     8761 aaaaagaacg ttcacggcga ctactgcact tatatacggt tctcccccac cctcgggaaa

     8821 aaggcggagc cagtacacga catcactttc ccagtttacc ccgcgccacc ttctctaggc

     8881 accggttcaa ttgccgaccc ctccccccaa cttctcgggg actgtgggcg atgtgcgctc

     8941 tgcccactga cgggcaccgg agccaattcc cactcctttc aagacctaga aggtccatta

     9001 gctgcaaaga ttcctctctg tttaaaactt tatccatctt tgcaaagctt atcgtcgaca

     9061 tcgcgatacc gtcgagatcc gttcactaat cgaatggatc tgtctctgtc tctctctcca

     9121 ccttcttctt ctattccttc gggcctgtcg ggtcccctcg gggttgggag gtgggtctga

     9181 aacgataatg gtgaatatcc ctgcctaact ctattcacta tagaaagtac agcaaaaact

     9241 attcttaaac ctaccaagcc tcctactatc attatgaata attttatata ccacagccaa

     9301 tttgttatgt taaaccaatt ccacaaactt gcccatttat ctaattccaa taattcttgt

     9361 tcattctttt cttgctggtt ttgcgattct tcaattaagg agtgtattaa gcttgtgtaa

     9421 ttgttaattt ctctgtccca ctccatccag gtcgtgtgat tccaaatctg ttccagagat

     9481 ttattactcc aactagcatt ccaaggcaca gcagtggtgc aaatgagttt tccagagcaa

     9541 ccccaaatcc ccaggagctg ttgatccttt aggtatcttt ccacagccag gattcttgcc

     9601 tggagctgct tgatgcccca gactgtgagt tgcaacagat gctgttgcgc ctcaatagcc

     9661 ctcagcaaat tgttctgctg ctgcactata ccagacaata attgtctggc ctgtaccgtc

     9721 agcgtcattg acgctgcgcc catagtgctt cctgctgctc ccaagaaccc aaggaacaaa

     9781 gctcctattc ccactgctct tttttctctc tgcaccactc ttctctttgc cttggtgggt

     9841 gctactccta atggttcaat ttttactact ttatatttat ataattcact tctccaattg

     9901 tccctcatat ctcctcctcc aggtctgaag atcagcggcc gcttgctgtg cggtggtctt

     9961 acttttgttt tgctcttcct ctatcttgtc taaagcttcc ttggtgtctt ttatctctat

    10021 cctttgatgc acacaataga gggttgctac tgtattatat aatgatctaa gttcttctga

    10081 tcctgtctga agggatggtt gtagctgtcc cagtatttgt ctacagcctt ctgatgtttc

    10141 taacaggcca ggattaactg cgaatcgttc tagctccctg cttgcccata ctatatgttt

    10201 taatttatat tttttctttc cccctggcct taaccgaatt ttttcccatc gcgatctaat

    10261 tctcccccgc ttaatactga cgctctcgca cccatctctc tccttctagc ctccgctagt

    10321 caaaattttt ggcgtactca ccagtcgccg cccctcgcct cttgccgtgc gcgcttcagc

    10381 aagccgagtc ctgcgtcgag agagctcctc tggtttccct ttcgctttca agtccctgtt

    10441 cgggcgccac tgctagagat tttccacact gactaaaagg gtctgaggga tctctagtta

    10501 ccagagtcac acaacagacg ggcacacact acttgaagca ctcaaggcaa gctttattga

    10561 ggcttaagca gtgggttccc tagttagcca gagagctccc aggctcagat ctggtctaac

    10621 cagagagacc cagtacaggc aaaaagcagc tgcttatatg caggatctga gggctcgcca

    10681 ctccccagtc ccgcccaggc cacgcctccc tggaaagtcc ccagcggaaa gtcccttgta

    10741 gcaagctcga tatcagcagt tcttgaagta ctccggatgc agctctcggg ccacgtgatg

    10801 aaatgctagg cggctgtcaa acctccactc taacacttct ctctccgggt catccatccc

    10861 atgcaggctc acagggtgta acaagctggt gttctctcct ttattggcct cttctacctt

    10921 atctggctca actggtacta gcttgtagca ccatccaaag gtcagtggat atctgacccc

    10981 tggccctggt gtgtagttct gctaatcagg gaagtagcct tgtgtgtggt agatccacag

    11041 atcaaggata tcttgtcttc tttgggagtg aattagccct tccaa

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart