pLVX- AcGFP1- N1 Plasmid

$136.00

  • Model: PVT2311
  • 50 Units in Stock
Ask a question


Add to Cart:

pLVX-AcGFP1-N1

Search name

pLVX-AcGFP1-N1,Plasmid pLVX-AcGFP1-N1,pLVX-AcGFP1-N1 vector

 

pLVX-AcGFP1-N1 Information

Promoter: PGK, CMV

Replicon: pUC ori

Terminator: SV40 poly (A) signal

Plasmid Classification: Virus Series, Lentivirus Cloning Vectors

Plasmid size: 8787bp

Prokaryotic resistance: Amp

Selection marker: Puro

Clone strain: Stbl3

Culture conditions: 37 C, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, transient expression

5'Sequencing Primers: CMV-F: CGCAAATGGGGGGGTAGGGGGGTG

3'Sequencing Primers: Designing Primers Based on Sequences

 

pLVX-AcGFP1-N1 Description

Plvx-acgfp1-n1 is HIV-1, a lentivirus expression vector.

The gene was cloned into the polyclonal site (MCS), and the coding sequence of ACGFP1 was located upstream. The expression of the N-terminal fusion protein of ACGFP1 was expressed by the human cytomegalovirus-driven early promoter (CMV) located upstream. Lentivirus particles come from vectors that allow AcGFP1 fusion protein to be expressed in almost any type of cell, including primary cells. The unmodifi ED vector represents AcGFP1 and can be used to optimize the infection protocol of production marker virus.

 

pLVX-AcGFP1-N1 Multiple cloning sites

pLVX-AcGFP1-N1-vector

 

pLVX-AcGFP1-N1 Sequence

LOCUS       Exported                8787 bp ds-DNA     circular SYN 27-AUG-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 23
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8787)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Saturday, August 27, 2016 from SnapGene Viewer 3.1.4
            
FEATURES             Location/Qualifiers
     source          1..8787
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     LTR             1..634
                     /note="3' LTR"
                     /note="3' long terminal repeat (LTR) from HIV-1"
     misc_feature    681..806
                     /note="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus 
                     type 1"
     misc_feature    1303..1536
                     /note="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for 
                     Rev-dependent mRNA export from the nucleus to the 
                     cytoplasm."
     misc_feature    2028..2143
                     /note="cPPT/CTS"
                     /note="central polypurine tract and central termination 
                     sequence of HIV-1 (lacking the first T)"
     enhancer        2201..2504
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        2505..2708
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     misc_feature    2793..2873
                     /note="MCS"
                     /note="multiple cloning site"
     CDS             2875..3594
                     /codon_start=1
                     /product="Aequorea coerulescens GFP"
                     /note="AcGFP1"
                     /note="mammalian codon-optimized"
                     /translation="MVSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDD
                     GNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYF
                     GFVTAAAITHGMDELYK"
     promoter        3622..4121
                     /note="PGK promoter"
                     /note="mouse phosphoglycerate kinase 1 promoter"
     CDS             4142..4741
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /note="PuroR"
                     /note="confers resistance to puromycin"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     misc_feature    4755..5343
                     /note="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional 
                     regulatory element"
     CDS             complement(5226..5237)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /note="Factor Xa site"
                     /translation="IEGR"
     LTR             5550..6183
                     /note="3' LTR"
                     /note="3' long terminal repeat (LTR) from HIV-1"
     primer_bind     complement(6312..6328)
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    6336..6352
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6360..6390)
                     /note="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    6405..6426
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding site"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(6714..7302)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7473..8333)
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart