pLVX- DsRed- Monomer- N1 Plasmid

$193.00

  • Model: PVT2312
  • 50 Units in Stock
Ask a question


Add to Cart:

pLVX-DsRed-Monomer-N1

Search name

pLVX-DsRed-Monomer-N1,Plasmid pLVX-DsRed-Monomer-N1,pLVX-DsRed-Monomer-N1 vector

 

pLVX-DsRed-Monomer-N1 Information

Promoter: PGK, CMV

Replicon: pUC ori

Terminator: SV40 poly (A) signal

Plasmid classification: virus series, lentivirus cloning vector

Plasmid size: 8751bp

Prokaryotic resistance: Amp

Screening markers: Puro

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pLVX-DsRed-Monomer-N1 Description

Plvx-dsred-monomer-n1 is a HIV-1, a lentivirus expression vector that allows you to express your interest in gene fusion, DsRed Monomer, a single mutant red fluorescent protein Discosoma sp.. The gene was cloned to the polyclonal site (MCS), which was located upstream of the gene coding sequence of the monomer and expressed as N's monomer protein fusion protein. The expression of fusion protein is composed of constitutive activated human cytomegalovirus immediate early promoter (CMV), which is located in the upstream MCS only. Lentivirus particles come from vectors that allow the expression of red fluorescent protein monomer fusion protein in almost any type of cells, including primary cells. The DsRed Monomer indicates that the unmodified vector can be used to produce labeled viruses and optimize the infection protocol.

Plvx-dsred-monomer-n1 contains all the necessary virus processing units to reproduce incompetent virus production, as well as elements to improve virus titer, transgene expression and overall carrier function. The post transcriptional regulatory element (WPRE) of the groundhog hepatitis virus (HBV) promotes RNA treatment events to increase the nuclear exportation of the virus and transgenic RNA, causing the virus titer to increase the packaging cells and enhance the expression of your genes in the target cells. In addition, the vector includes Rev response element (RRE), which further increases the titer of virus and enhances the transport of spliced virus RNA into the nucleus. Finally, pLVX DsRed - monomer-n1 also contains a central polypurine channel (CPPT) element that increases the input of the virus genome in the process of target cell infection, leading to improved carrier integration and more effective transduction.

pLVX-DsRed-Monomer-N1-vector

 

pLVX-DsRed-Monomer-N1 Sequence

LOCUS       Exported                8751 bp ds-DNA     circular SYN 07-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 3
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8751)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Wednesday, September 7, 2016 from SnapGene Viewer 3.1.4
            
FEATURES             Location/Qualifiers
     source          1..8751
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     LTR             1..634
                     /note="3' LTR"
                     /note="3' long terminal repeat (LTR) from HIV-1"
     misc_feature    681..806
                     /note="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus 
                     type 1"
     misc_feature    1303..1536
                     /note="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for 
                     Rev-dependent mRNA export from the nucleus to the 
                     cytoplasm."
     misc_feature    2028..2143
                     /note="cPPT/CTS"
                     /note="central polypurine tract and central termination 
                     sequence of HIV-1 (lacking the first T)"
     enhancer        2201..2504
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        2505..2708
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     misc_feature    2793..2873
                     /note="MCS"
                     /note="multiple cloning site"
     CDS             2881..3558
                     /codon_start=1
                     /product="monomeric derivative of DsRed fluorescent protein
                     (Strongin et al., 2007)"
                     /note="DsRed-Monomer"
                     /note="mammalian codon-optimized"
                     /translation="MDNTEDVIKEFMQFKVRMEGSVNGHYFEIEGEGEGKPYEGTQTAK
                     LQVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYMKLSFPEGFTWERSMNFEDGGV
                     VEVQQDSSLQDGTFIYKVKFKGVNFPADGPVMQKKTAGWEPSTEKLYPQDGVLKGEISH
                     ALKLKDGGHYTCDFKTVYKAKKPVQLPGNHYVDSKLDITNHNEDYTVVEQYEHAEARHS
                     GSQ"
     promoter        3587..4086
                     /note="PGK promoter"
                     /note="mouse phosphoglycerate kinase 1 promoter"
     CDS             4107..4706
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /note="PuroR"
                     /note="confers resistance to puromycin"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     misc_feature    4720..5308
                     /note="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional 
                     regulatory element"
     CDS             complement(5191..5202)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /note="Factor Xa site"
                     /translation="IEGR"
     LTR             5515..6148
                     /note="3' LTR"
                     /note="3' long terminal repeat (LTR) from HIV-1"
     primer_bind     complement(6276..6292)
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    6300..6316
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6324..6354)
                     /note="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    6369..6390
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding site"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(6678..7266)
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart