pLVX- TET3G

$216.00

  • Model: PVT11073
  • 50 Units in Stock
Ask a question


Add to Cart:

pLVX-TET3G


Catalog No. PVT11073
Packing 2ug

 

pLVX-TET3G Information

Promoter: CMV

Replicon: pUC ori

Terminator: SV40 poly (A) signal

Plasmid Classification: Virus Series, Lentivirus Cloning Vectors

Plasmid size: 9051 BP

Prokaryotic resistance: Amp

Cloning strain: Stbl3

Culture conditions: 37 C, aerobic LB

Expression host: mammalian cells

Induction mode: tetracycline induction

5'Sequencing Primers: CMV-F: CGCAAATGGGGGGGTAGGGGGGTG

3'Sequencing Primers: Designing Primers Based on Sequences

 

pLVX-TET3G Description

Plvx-tet3g is a stable expression vector of Tet, a transcription activator protein of 3G. As a part of any lenti-x', Tet can induce the expression of 3G. The lenti-x TET of the 3G inducible expression system allows viruses to deliver and induce expression of genes of interest in a wide variety of mammalian cells. The expressed target cell Tet transactivator for 3G will express your gene at a high level from plvx-tet3g and a ptre3g promoter controlled by the target gene, only in the presence of doxycycline.

 

pLVX-TET3G Sites

pLVX-Tet3G-vector

 

 

 

pLVX-TET3G Sequence

LOCUS       Exported                9051 bp ds-DNA     circular SYN 29-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pLVX-Tet3G

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9051)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Thursday, September 8, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..9051

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             1..634

                     /note="3' LTR"

                     /note="3' long terminal repeat (LTR) from HIV-1"

     misc_feature    681..806

                     /note="HIV-1 Psi"

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     misc_feature    1303..1536

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    2028..2143

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1 (lacking the first T)"

     enhancer        2201..2504

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        2505..2708

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     CDS             2821..3567

                     /codon_start=1

                     /product="modified rtTA protein that binds tightly to 

                     promoters containing the tet operator in the presence of 

                     doxycycline"

                     /note="Tet-On(R) 3G"

                     /translation="MSRLDKSKVINSALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHV

                     KNKRALLDALPIEMLDRHHTHSCPLEGESWQDFLRNNAKSYRCALLSHRDGAKVHLGTR

                     PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEEQEHQVAKEERETPTT

                     DSMPPLLKQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPTDALDDFDLDMLPA

                     DALDDFDLDMLPADALDDFDLDMLPG"

     misc_feature    3576..4148

                     /note="IRES"

                     /note="internal ribosome entry site (IRES) of the 

                     encephalomyocarditis virus (EMCV)"

     CDS             4162..4956

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MAEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     misc_feature    4970..5558

                     /note="WPRE"

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     CDS             complement(5441..5452)

                     /codon_start=1

                     /product="Factor Xa recognition and cleavage site"

                     /note="Factor Xa site"

                     /translation="IEGR"

     LTR             5766..6399

                     /note="3' LTR"

                     /note="3' long terminal repeat (LTR) from HIV-1"

     primer_bind     complement(6528..6544)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    6552..6568

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(6576..6606)

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    6621..6642

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(6930..7518)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7689..8549)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(8550..8654)

                     /gene="bla"

                     /note="AmpR promoter"

     polyA_signal    8702..8836

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

ORIGIN

        1 tggaagggct aattcactcc caaagaagac aagatatcct tgatctgtgg atctaccaca

       61 cacaaggcta cttccctgat tagcagaact acacaccagg gccaggggtc agatatccac

      121 tgacctttgg atggtgctac aagctagtac cagttgagcc agataaggta gaagaggcca

      181 ataaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatgggatg gatgacccgg

      241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac gtggcccgag

      301 agctgcatcc ggagtacttc aagaactgct gatatcgagc ttgctacaag ggactttccg

      361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat

      421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga

      481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct

      541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc

      601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacttgaaag

      661 cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg

      721 caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga

      781 aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgcgatggg

      841 aaaaaattcg gttaaggcca gggggaaaga aaaaatataa attaaaacat atagtatggg

      901 caagcaggga gctagaacga ttcgcagtta atcctggcct gttagaaaca tcagaaggct

      961 gtagacaaat actgggacag ctacaaccat cccttcagac aggatcagaa gaacttagat

     1021 cattatataa tacagtagca accctctatt gtgtgcatca aaggatagag ataaaagaca

     1081 ccaaggaagc tttagacaag atagaggaag agcaaaacaa aagtaagacc accgcacagc

     1141 aagcggccgg ccgctgatct tcagacctgg aggaggagat atgagggaca attggagaag

     1201 tgaattatat aaatataaag tagtaaaaat tgaaccatta ggagtagcac ccaccaaggc

     1261 aaagagaaga gtggtgcaga gagaaaaaag agcagtggga ataggagctt tgttccttgg

     1321 gttcttggga gcagcaggaa gcactatggg cgcagcgtca atgacgctga cggtacaggc

     1381 cagacaatta ttgtctggta tagtgcagca gcagaacaat ttgctgaggg ctattgaggc

     1441 gcaacagcat ctgttgcaac tcacagtctg gggcatcaag cagctccagg caagaatcct

     1501 ggctgtggaa agatacctaa aggatcaaca gctcctgggg atttggggtt gctctggaaa

     1561 actcatttgc accactgctg tgccttggaa tgctagttgg agtaataaat ctctggaaca

     1621 gatttggaat cacacgacct ggatggagtg ggacagagaa attaacaatt acacaagctt

     1681 aatacactcc ttaattgaag aatcgcaaaa ccagcaagaa aagaatgaac aagaattatt

     1741 ggaattagat aaatgggcaa gtttgtggaa ttggtttaac ataacaaatt ggctgtggta

     1801 tataaaatta ttcataatga tagtaggagg cttggtaggt ttaagaatag tttttgctgt

     1861 actttctata gtgaatagag ttaggcaggg atattcacca ttatcgtttc agacccacct

     1921 cccaaccccg aggggacccg acaggcccga aggaatagaa gaagaaggtg gagagagaga

     1981 cagagacaga tccattcgat tagtgaacgg atctcgacgg tatcgccttt aaaagaaaag

     2041 gggggattgg ggggtacagt gcaggggaaa gaatagtaga cataatagca acagacatac

     2101 aaactaaaga actacaaaaa caaattacaa aaattcaaaa ttttcgggtt tattacaggg

     2161 acagcagaga tccagtttat cgataagctt gggagttccg cgttacataa cttacggtaa

     2221 atggcccgcc tggctgaccg cccaacgacc cccgcccatt gacgtcaata atgacgtatg

     2281 ttcccatagt aacgccaata gggactttcc attgacgtca atgggtggag tatttacggt

     2341 aaactgccca cttggcagta catcaagtgt atcatatgcc aagtacgccc cctattgacg

     2401 tcaatgacgg taaatggccc gcctggcatt atgcccagta catgacctta tgggactttc

     2461 ctacttggca gtacatctac gtattagtca tcgctattac catggtgatg cggttttggc

     2521 agtacatcaa tgggcgtgga tagcggtttg actcacgggg atttccaagt ctccacccca

     2581 ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg ggactttcca aaatgtcgta

     2641 acaactccgc cccattgacg caaatgggcg gtaggcgtgt acggtgggag gtctatataa

     2701 gcagagctcg tttagtgaac cgtcagatcg cctggagacg ccatccacgc tgttttgacc

     2761 tccatagaag acaccgactc tactagagga tctatttccg gtgaattcct cgaggccacc

     2821 atgtctagac tggacaagag caaagtcata aactctgctc tggaattact caatggagtc

     2881 ggtatcgaag gcctgacgac aaggaaactc gctcaaaagc tgggagttga gcagcctacc

     2941 ctgtactggc acgtgaagaa caagcgggcc ctgctcgatg ccctgccaat cgagatgctg

     3001 gacaggcatc atacccactc ctgccccctg gaaggcgagt catggcaaga ctttctgcgg

     3061 aacaacgcca agtcataccg ctgtgctctc ctctcacatc gcgacggggc taaagtgcat

     3121 ctcggcaccc gcccaacaga gaaacagtac gaaaccctgg aaaatcagct cgcgttcctg

     3181 tgtcagcaag gcttctccct ggagaacgca ctgtacgctc tgtccgccgt gggccacttt

     3241 acactgggct gcgtattgga ggaacaggag catcaagtag caaaagagga aagagagaca

     3301 cctaccaccg attctatgcc cccacttctg aaacaagcaa ttgagctgtt cgaccggcag

     3361 ggagccgaac ctgccttcct tttcggcctg gaactaatca tatgtggcct ggagaaacag

     3421 ctaaagtgcg aaagcggcgg gccgaccgac gcccttgacg attttgactt agacatgctc

     3481 ccagccgatg cccttgacga ctttgacctt gatatgctgc ctgctgacgc tcttgacgat

     3541 tttgaccttg acatgctccc cgggtaagga tcccgcccct ctccctcccc cccccctaac

     3601 gttactggcc gaagccgctt ggaataaggc cggtgtgcgt ttgtctatat gttattttcc

     3661 accatattgc cgtcttttgg caatgtgagg gcccggaaac ctggccctgt cttcttgacg

     3721 agcattccta ggggtctttc ccctctcgcc aaaggaatgc aaggtctgtt gaatgtcgtg

     3781 aaggaagcag ttcctctgga agcttcttga agacaaacaa cgtctgtagc gaccctttgc

     3841 aggcagcgga accccccacc tggcgacagg tgcctctgcg gccaaaagcc acgtgtataa

     3901 gatacacctg caaaggcggc acaaccccag tgccacgttg tgagttggat agttgtggaa

     3961 agagtcaaat ggctctcctc aagcgtattc aacaaggggc tgaaggatgc ccagaaggta

     4021 ccccattgta tgggatctga tctggggcct cggtgcacat gctttacatg tgtttagtcg

     4081 aggttaaaaa acgtctaggc cccccgaacc acggggacgt ggttttcctt tgaaaaacac

     4141 gatgataagc ttgccacaac catggctgaa caagatggat tgcacgcagg ttctccggcc

     4201 gcttgggtgg agaggctatt cggctatgac tgggcacaac agacaatcgg ctgctctgat

     4261 gccgccgtgt tccggctgtc agcgcagggg cgcccggttc tttttgtcaa gaccgacctg

     4321 tccggtgccc tgaatgaact gcaggacgag gcagcgcggc tatcgtggct ggccacgacg

     4381 ggcgttcctt gcgcagctgt gctcgacgtt gtcactgaag cgggaaggga ctggctgcta

     4441 ttgggcgaag tgccggggca ggatctcctg tcatctcacc ttgctcctgc cgagaaagta

     4501 tccatcatgg ctgatgcaat gcggcggctg catacgcttg atccggctac ctgcccattc

     4561 gaccaccaag cgaaacatcg catcgagcga gcacgtactc ggatggaagc cggtcttgtc

     4621 gatcaggatg atctggacga agagcatcag gggctcgcgc cagccgaact gttcgccagg

     4681 ctcaaggcgc gcatgcccga cggcgaggat ctcgtcgtga cccatggcga tgcctgcttg

     4741 ccgaatatca tggtggaaaa tggccgcttt tctggattca tcgactgtgg ccggctgggt

     4801 gtggcggacc gctatcagga catagcgttg gctacccgtg atattgctga agagcttggc

     4861 ggcgaatggg ctgaccgctt cctcgtgctt tacggtatcg ccgctcccga ttcgcagcgc

     4921 atcgccttct atcgccttct tgacgagttc ttctgaacgc gtctggaaca atcaacctct

     4981 ggattacaaa atttgtgaaa gattgactgg tattcttaac tatgttgctc cttttacgct

     5041 atgtggatac gctgctttaa tgcctttgta tcatgctatt gcttcccgta tggctttcat

     5101 tttctcctcc ttgtataaat cctggttgct gtctctttat gaggagttgt ggcccgttgt

     5161 caggcaacgt ggcgtggtgt gcactgtgtt tgctgacgca acccccactg gttggggcat

     5221 tgccaccacc tgtcagctcc tttccgggac tttcgctttc cccctcccta ttgccacggc

     5281 ggaactcatc gccgcctgcc ttgcccgctg ctggacaggg gctcggctgt tgggcactga

     5341 caattccgtg gtgttgtcgg ggaagctgac gtcctttcca tggctgctcg cctgtgttgc

     5401 cacctggatt ctgcgcggga cgtccttctg ctacgtccct tcggccctca atccagcgga

     5461 ccttccttcc cgcggcctgc tgccggctct gcggcctctt ccgcgtcttc gccttcgccc

     5521 tcagacgagt cggatctccc tttgggccgc ctccccgcct ggaattaatt ctgcagtcga

     5581 gacctagaaa aacatggagc aatcacaagt agcaatacag cagctaccaa tgctgattgt

     5641 gcctggctag aagcacaaga ggaggaggag gtgggttttt ccagtcacac ctcaggtacc

     5701 tttaagacca atgacttaca aggcagctgt agatcttagc cactttttaa aagaaaagag

     5761 gggactggaa gggctaattc actcccaacg aagacaagat atccttgatc tgtggatcta

     5821 ccacacacaa ggctacttcc ctgattagca gaactacaca ccagggccag gggtcagata

     5881 tccactgacc tttggatggt gctacaagct agtaccagtt gagccagata aggtagaaga

     5941 ggccaataaa ggagagaaca ccagcttgtt acaccctgtg agcctgcatg ggatggatga

     6001 cccggagaga gaagtgttag agtggaggtt tgacagccgc ctagcatttc atcacgtggc

     6061 ccgagagctg catccggagt acttcaagaa ctgctgatat cgagcttgct acaagggact

     6121 ttccgctggg gactttccag ggaggcgtgg cctgggcggg actggggagt ggcgagccct

     6181 cagatcctgc atataagcag ctgctttttg cctgtactgg gtctctctgg ttagaccaga

     6241 tctgagcctg ggagctctct ggctaactag ggaacccact gcttaagcct caataaagct

     6301 tgccttgagt gcttcaagta gtgtgtgccc gtctgttgtg tgactctggt aactagagat

     6361 ccctcagacc cttttagtca gtgtggaaaa tctctagcag tagtagttca tgtcatctta

     6421 ttattcagta tttataactt gcaaagaaat gaatatcaga gagtgagagg ccttgacatt

     6481 gctagcgttt taccgtcgac ctctagctag agcttggcgt aatcatggtc atagctgttt

     6541 cctgtgtgaa attgttatcc gctcacaatt ccacacaaca tacgagccgg aagcataaag

     6601 tgtaaagcct ggggtgccta atgagtgagc taactcacat taattgcgtt gcgctcactg

     6661 cccgctttcc agtcgggaaa cctgtcgtgc cagctgcatt aatgaatcgg ccaacgcgcg

     6721 gggagaggcg gtttgcgtat tgggcgctct tccgcttcct cgctcactga ctcgctgcgc

     6781 tcggtcgttc ggctgcggcg agcggtatca gctcactcaa aggcggtaat acggttatcc

     6841 acagaatcag gggataacgc aggaaagaac atgtgagcaa aaggccagca aaaggccagg

     6901 aaccgtaaaa aggccgcgtt gctggcgttt ttccataggc tccgcccccc tgacgagcat

     6961 cacaaaaatc gacgctcaag tcagaggtgg cgaaacccga caggactata aagataccag

     7021 gcgtttcccc ctggaagctc cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga

     7081 tacctgtccg cctttctccc ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg

     7141 tatctcagtt cggtgtaggt cgttcgctcc aagctgggct gtgtgcacga accccccgtt

     7201 cagcccgacc gctgcgcctt atccggtaac tatcgtcttg agtccaaccc ggtaagacac

     7261 gacttatcgc cactggcagc agccactggt aacaggatta gcagagcgag gtatgtaggc

     7321 ggtgctacag agttcttgaa gtggtggcct aactacggct acactagaag aacagtattt

     7381 ggtatctgcg ctctgctgaa gccagttacc ttcggaaaaa gagttggtag ctcttgatcc

     7441 ggcaaacaaa ccaccgctgg tagcggtggt ttttttgttt gcaagcagca gattacgcgc

     7501 agaaaaaaag gatctcaaga agatcctttg atcttttcta cggggtctga cgctcagtgg

     7561 aacgaaaact cacgttaagg gattttggtc atgagattat caaaaaggat cttcacctag

     7621 atccttttaa attaaaaatg aagttttaaa tcaatctaaa gtatatatga gtaaacttgg

     7681 tctgacagtt accaatgctt aatcagtgag gcacctatct cagcgatctg tctatttcgt

     7741 tcatccatag ttgcctgact ccccgtcgtg tagataacta cgatacggga gggcttacca

     7801 tctggcccca gtgctgcaat gataccgcga gacccacgct caccggctcc agatttatca

     7861 gcaataaacc agccagccgg aagggccgag cgcagaagtg gtcctgcaac tttatccgcc

     7921 tccatccagt ctattaattg ttgccgggaa gctagagtaa gtagttcgcc agttaatagt

     7981 ttgcgcaacg ttgttgccat tgctacaggc atcgtggtgt cacgctcgtc gtttggtatg

     8041 gcttcattca gctccggttc ccaacgatca aggcgagtta catgatcccc catgttgtgc

     8101 aaaaaagcgg ttagctcctt cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg

     8161 ttatcactca tggttatggc agcactgcat aattctctta ctgtcatgcc atccgtaaga

     8221 tgcttttctg tgactggtga gtactcaacc aagtcattct gagaatagtg tatgcggcga

     8281 ccgagttgct cttgcccggc gtcaatacgg gataataccg cgccacatag cagaacttta

     8341 aaagtgctca tcattggaaa acgttcttcg gggcgaaaac tctcaaggat cttaccgctg

     8401 ttgagatcca gttcgatgta acccactcgt gcacccaact gatcttcagc atcttttact

     8461 ttcaccagcg tttctgggtg agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata

     8521 agggcgacac ggaaatgttg aatactcata ctcttccttt ttcaatatta ttgaagcatt

     8581 tatcagggtt attgtctcat gagcggatac atatttgaat gtatttagaa aaataaacaa

     8641 ataggggttc cgcgcacatt tccccgaaaa gtgccacctg acgtcgacgg atcgggagat

     8701 caacttgttt attgcagctt ataatggtta caaataaagc aatagcatca caaatttcac

     8761 aaataaagca tttttttcac tgcattctag ttgtggtttg tccaaactca tcaatgtatc

     8821 ttatcatgtc tggatcaact ggataactca agctaaccaa aatcatccca aacttcccac

     8881 cccataccct attaccactg ccaattacct agtggtttca tttactctaa acctgtgatt

     8941 cctctgaatt attttcattt taaagaaatt gtatttgtta aatatgtact acaaacttag

     9001 tagtttttaa agaaattgta tttgttaaat atgtactaca aacttagtag t

//


Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart