pLVX- TRE3G- Zsgreen1

$136.00

  • Model: PVT2328
  • 50 Units in Stock
Ask a question


Add to Cart:

pLVX-TRE3G-Zsgreen1

PVT2328       2ug

 

pLVX-TRE3G-Zsgreen1 Information
Promoter: TRE3GV, PGK
Replicon: pUC ori
Terminator: SV40 poly (A) signal
Plasmid classification: virus series, lentivirus cloning vector
Plasmid size: 9100bp
Prokaryotic resistance: Amp
Screening markers: Puro
Cloned strain: Stbl3
Culture conditions: 37 centigrade, aerobic LB
Expression host: mammalian cells
Inducement: tetracycline induction
5'sequencing primers: M13R:CAGGAAACAGCTATGACC
3'sequencing primers: primers designed according to sequence
Use:Lentiviral

 

pLVX-TRE3G-Zsgreen1 Description

The inducible promoter PTRE3G provides for very low basal expression and high maximal expression after induction. It consists of 7 repeats of a 19 bp tet operator sequence located upstream of a minimal CMV promoter. PTRE3GV is a version of PTRE3G that was modified at Clontech for higher performance in lentiviruses and retroviruses. In the presence of Dox, Tet-On 3G binds specifically to PTRE3GV and activates transcription of the downstream GOI. PTRE3GV lacks binding sites for endogenous mammalian transcription factors, so it is virtually silent in the absence of induction. pLVX-TRE3G-ZsGreen1 is an HIV-1-based, inducible lentiviral expression vector that allows the simultaneous expression of ZsGreen1 and your protein of interest in virtually any mammalian cell type, including primary cells.

pLVX-TRE3G-Zsgreen1-plasmid

 

pLVX-TRE3G-Zsgreen1 Sequence

LOCUS       Exported                9100 bp ds-DNA     circular SYN 27-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 35

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9100)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Saturday, August 27, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..9100

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             1..634

                     /note="3' LTR"

                     /note="3' long terminal repeat (LTR) from HIV-1"

     misc_feature    681..806

                     /note="HIV-1 Psi"

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     misc_feature    1303..1536

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    2028..2143

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1 (lacking the first T)"

     promoter        2206..2555

                     /note="TRE3GV promoter"

                     /note="3rd-generation Tet-responsive promoter that can be 

                     activated by binding of Tet-On(R) 3G, optimized for 

                     retroviral and lentiviral vectors"

     protein_bind    2214..2232

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2250..2268

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2286..2304

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2322..2340

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2358..2376

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2394..2412

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     protein_bind    2430..2448

                     /gene="tetO"

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tet operator"

                     /note="bacterial operator O2 for the tetR and tetA genes"

     misc_feature    3275..3849

                     /note="IRES"

                     /note="internal ribosome entry site (IRES) of the 

                     encephalomyocarditis virus (EMCV)"

     misc_feature    3299..3851

                     /note="IRES"

                     /note="internal ribosome entry site (IRES) of the 

                     encephalomyocarditis virus (EMCV)"

     promoter        3885..4384

                     /note="PGK promoter"

                     /note="mouse phosphoglycerate kinase 1 promoter"

     CDS             4405..5004

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /note="PuroR"

                     /note="confers resistance to puromycin"

                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER

                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA

                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS

                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     misc_feature    5022..5610

                     /note="WPRE"

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     CDS             complement(5493..5504)

                     /codon_start=1

                     /product="Factor Xa recognition and cleavage site"

                     /note="Factor Xa site"

                     /translation="IEGR"

     LTR             5818..6451

                     /note="3' LTR"

                     /note="3' long terminal repeat (LTR) from HIV-1"

     primer_bind     complement(6580..6596)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    6604..6620

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(6628..6658)

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    6673..6694

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(6982..7567)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7738..8598)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(8599..8703)

                     /gene="bla"

                     /note="AmpR promoter"

     polyA_signal    8751..8885

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

ORIGIN

        1 tggaagggct aattcactcc caaagaagac aagatatcct tgatctgtgg atctaccaca

       61 cacaaggcta cttccctgat tagcagaact acacaccagg gccaggggtc agatatccac

      121 tgacctttgg atggtgctac aagctagtac cagttgagcc agataaggta gaagaggcca

      181 ataaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatgggatg gatgacccgg

      241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac gtggcccgag

      301 agctgcatcc ggagtacttc aagaactgct gatatcgagc ttgctacaag ggactttccg

      361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat

      421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga

      481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct

      541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc

      601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacttgaaag

      661 cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg

      721 caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga

      781 aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgcgatggg

      841 aaaaaattcg gttaaggcca gggggaaaga aaaaatataa attaaaacat atagtatggg

      901 caagcaggga gctagaacga ttcgcagtta atcctggcct gttagaaaca tcagaaggct

      961 gtagacaaat actgggacag ctacaaccat cccttcagac aggatcagaa gaacttagat

     1021 cattatataa tacagtagca accctctatt gtgtgcatca aaggatagag ataaaagaca

     1081 ccaaggaagc tttagacaag atagaggaag agcaaaacaa aagtaagacc accgcacagc

     1141 aagcggccgg ccgctgatct tcagacctgg aggaggagat atgagggaca attggagaag

     1201 tgaattatat aaatataaag tagtaaaaat tgaaccatta ggagtagcac ccaccaaggc

     1261 aaagagaaga gtggtgcaga gagaaaaaag agcagtggga ataggagctt tgttccttgg

     1321 gttcttggga gcagcaggaa gcactatggg cgcagcgtca atgacgctga cggtacaggc

     1381 cagacaatta ttgtctggta tagtgcagca gcagaacaat ttgctgaggg ctattgaggc

     1441 gcaacagcat ctgttgcaac tcacagtctg gggcatcaag cagctccagg caagaatcct

     1501 ggctgtggaa agatacctaa aggatcaaca gctcctgggg atttggggtt gctctggaaa

     1561 actcatttgc accactgctg tgccttggaa tgctagttgg agtaataaat ctctggaaca

     1621 gatttggaat cacacgacct ggatggagtg ggacagagaa attaacaatt acacaagctt

     1681 aatacactcc ttaattgaag aatcgcaaaa ccagcaagaa aagaatgaac aagaattatt

     1741 ggaattagat aaatgggcaa gtttgtggaa ttggtttaac ataacaaatt ggctgtggta

     1801 tataaaatta ttcataatga tagtaggagg cttggtaggt ttaagaatag tttttgctgt

     1861 actttctata gtgaatagag ttaggcaggg atattcacca ttatcgtttc agacccacct

     1921 cccaaccccg aggggacccg acaggcccga aggaatagaa gaagaaggtg gagagagaga

     1981 cagagacaga tccattcgat tagtgaacgg atctcgacgg tatcgccttt aaaagaaaag

     2041 gggggattgg ggggtacagt gcaggggaaa gaatagtaga cataatagca acagacatac

     2101 aaactaaaga attacaaaaa caaattacaa aaattcaaaa ttttcgggtt tattacaggg

     2161 acagcagaga tccagtttat cgatgaggcc ctttcgtctt cactcgagtt tactccctat

     2221 cagtgataga gaacgtatga agagtttact ccctatcagt gatagagaac gtatgcagac

     2281 tttactccct atcagtgata gagaacgtat aaggagttta ctccctatca gtgatagaga

     2341 acgtatgacc agtttactcc ctatcagtga tagagaacgt atctacagtt tactccctat

     2401 cagtgataga gaacgtatat ccagtttact ccctatcagt gatagagaac gtatgtcgag

     2461 gtaggcgtgt acggtgggcg cctataaaag cagagctcgt ttagtgaacc gtcagatcgc

     2521 ctggagcaat tccacaacac ttttgtctta tacttggatc accatggctc agtcaaagca

     2581 cggcctgacc aaggagatga ccatgaagta ccgcatggag ggctgcgtgg acggccacaa

     2641 gttcgtgatc accggcgagg gcatcggcta ccccttcaag ggcaagcagg ccatcaacct

     2701 gtgcgtggtg gagggcggcc ccttgccctt cgccgaggac atcttgtccg ccgccttcat

     2761 gtacggcaac cgcgtgttca ccgagtaccc ccaggacatc gtcgactact tcaagaactc

     2821 ctgccccgcc ggctacacct gggaccgctc cttcctgttc gaggacggcg ccgtgtgcat

     2881 ctgcaacgcc gacatcaccg tgagcgtgga ggagaactgc atgtaccacg agtccaagtt

     2941 ctacggcgtg aacttccccg ccgacggccc cgtgatgaag aagatgaccg acaactggga

     3001 gccctcctgc gagaagatca tccccgtgcc caagcagggc atcttgaagg gcgacgtgag

     3061 catgtacctg ctgctgaagg acggtggccg cttgcgctgc cagttcgaca ccgtgtacaa

     3121 ggccaagtcc gtgccccgca agatgcccga ctggcacttc atccagcaca agctgacccg

     3181 cgaggaccgc agcgacgcca agaaccagaa gtggcacctg accgagcacg ccatcgcctc

     3241 cggatctgca ttgccctgag gccgccccgg ccggcccctc tccctccccc cccccctaac

     3301 gttactggcc gaagccgctt ggaataaggc cggtgtgcgt ttgtctatat gttattttcc

     3361 accatattgc cgtcttttgg caatgtgagg gcccggaaac ctggccctgt cttcttgacg

     3421 agcattccta ggggtctttc ccctctcgcc aaaggaatgc aaggtctgtt gaatgtcgtg

     3481 aaggaagcag ttcctctgga agcttcttga agacaaacaa cgtctgtagc gaccctttgc

     3541 aggcagcgga accccccacc tggcgacagg tgcctctgcg gccaaaagcc acgtgtataa

     3601 gatacacctg caaaggcggc acaaccccag tgccacgttg tgagttggat agttgtggaa

     3661 agagtcaaat ggctctcctc aagcgtattc aacaaggggc tgaaggatgc ccagaaggta

     3721 ccccattgta tgggatctga tctggggcct cggtacacat gctttacatg tgtttagtcg

     3781 aggttaaaaa aacgtctagg ccccccgaac cacggggacg tggttttcct ttgaaaaaca

     3841 cgatgataat atggcccccg ggacgcgtca tatggaattc taccgggtag gggaggcgct

     3901 tttcccaagg cagtctggag catgcgcttt agcagccccg ctgggcactt ggcgctacac

     3961 aagtggcctc tggcctcgca cacattccac atccaccggt aggcgccaac cggctccgtt

     4021 ctttggtggc cccttcgcgc caccttctac tcctccccta gtcaggaagt tcccccccgc

     4081 cccgcagctc gcgtcgtgca ggacgtgaca aatggaagta gcacgtctca ctagtctcgt

     4141 gcagatggac agcaccgctg agcaatggaa gcgggtaggc ctttggggca gcggccaata

     4201 gcagctttgc tccttcgctt tctgggctca gaggctggga aggggtgggt ccgggggcgg

     4261 gctcaggggc gggctcaggg gcggggcggg cgcccgaagg tcctccggag gcccggcatt

     4321 ctgcacgctt caaaagcgca cgtctgccgc gctgttctcc tcttcctcat ctccgggcct

     4381 ttcgacctgc agcccaagct taccatgacc gagtacaagc ccacggtgcg cctcgccacc

     4441 cgcgacgacg tccccagggc cgtacgcacc ctcgccgccg cgttcgccga ctaccccgcc

     4501 acgcgccaca ccgtcgatcc ggaccgccac atcgagcggg tcaccgagct gcaagaactc

     4561 ttcctcacgc gcgtcgggct cgacatcggc aaggtgtggg tcgcggacga cggcgccgcg

     4621 gtggcggtct ggaccacgcc ggagagcgtc gaagcggggg cggtgttcgc cgagatcggc

     4681 ccgcgcatgg ccgagttgag cggttcccgg ctggccgcgc agcaacagat ggaaggcctc

     4741 ctggcgccgc accggcccaa ggagcccgcg tggttcctgg ccaccgtcgg cgtctcgccc

     4801 gaccaccagg gcaagggtct gggcagcgcc gtcgtgctcc ccggagtgga ggcggccgag

     4861 cgcgccgggg tgcccgcctt cctggagacc tccgcgcccc gcaacctccc cttctacgag

     4921 cggctcggct tcaccgtcac cgccgacgtc gaggtgcccg aaggaccgcg cacctggtgc

     4981 atgacccgca agcccggtgc ctgacggggc gcgtctggaa caatcaacct ctggattaca

     5041 aaatttgtga aagattgact ggtattctta actatgttgc tccttttacg ctatgtggat

     5101 acgctgcttt aatgcctttg tatcatgcta ttgcttcccg tatggctttc attttctcct

     5161 ccttgtataa atcctggttg ctgtctcttt atgaggagtt gtggcccgtt gtcaggcaac

     5221 gtggcgtggt gtgcactgtg tttgctgacg caacccccac tggttggggc attgccacca

     5281 cctgtcagct cctttccggg actttcgctt tccccctccc tattgccacg gcggaactca

     5341 tcgccgcctg ccttgcccgc tgctggacag gggctcggct gttgggcact gacaattccg

     5401 tggtgttgtc ggggaagctg acgtcctttc catggctgct cgcctgtgtt gccacctgga

     5461 ttctgcgcgg gacgtccttc tgctacgtcc cttcggccct caatccagcg gaccttcctt

     5521 cccgcggcct gctgccggct ctgcggcctc ttccgcgtct tcgccttcgc cctcagacga

     5581 gtcggatctc cctttgggcc gcctccccgc ctggaattaa ttctgcagtc gagacctaga

     5641 aaaacatgga gcaatcacaa gtagcaatac agcagctacc aatgctgatt gtgcctggct

     5701 agaagcacaa gaggaggagg aggtgggttt ttccagtcac acctcaggta cctttaagac

     5761 caatgactta caaggcagct gtagatctta gccacttttt aaaagaaaag aggggactgg

     5821 aagggctaat tcactcccaa cgaagacaag atatccttga tctgtggatc taccacacac

     5881 aaggctactt ccctgattag cagaactaca caccagggcc aggggtcaga tatccactga

     5941 cctttggatg gtgctacaag ctagtaccag ttgagccaga taaggtagaa gaggccaata

     6001 aaggagagaa caccagcttg ttacaccctg tgagcctgca tgggatggat gacccggaga

     6061 gagaagtgtt agagtggagg tttgacagcc gcctagcatt tcatcacgtg gcccgagagc

     6121 tgcatccgga gtacttcaag aactgctgat atcgagcttg ctacaaggga ctttccgctg

     6181 gggactttcc agggaggcgt ggcctgggcg ggactgggga gtggcgagcc ctcagatcct

     6241 gcatataagc agctgctttt tgcctgtact gggtctctct ggttagacca gatctgagcc

     6301 tgggagctct ctggctaact agggaaccca ctgcttaagc ctcaataaag cttgccttga

     6361 gtgcttcaag tagtgtgtgc ccgtctgttg tgtgactctg gtaactagag atccctcaga

     6421 cccttttagt cagtgtggaa aatctctagc agtagtagtt catgtcatct tattattcag

     6481 tatttataac ttgcaaagaa atgaatatca gagagtgaga ggccttgaca ttgctagcgt

     6541 tttaccgtcg acctctagct agagcttggc gtaatcatgg tcatagctgt ttcctgtgtg

     6601 aaattgttat ccgctcacaa ttccacacaa catacgagcc ggaagcataa agtgtaaagc

     6661 ctggggtgcc taatgagtga gctaactcac attaattgcg ttgcgctcac tgcccgcttt

     6721 ccagtcggga aacctgtcgt gccagctgca ttaatgaatc ggccaacgcg cggggagagg

     6781 cggtttgcgt attgggcgct cttccgcttc ctcgctcact gactcgctgc gctcggtcgt

     6841 tcggctgcgg cgagcggtat cagctcactc aaaggcggta atacggttat ccacagaatc

     6901 aggggataac gcaggaaaga acatgtgagc aaaaggccag caaaaggcca ggaaccgtaa

     6961 aaaggccgcg ttgctggcgt ttttccatag gctccgcccc cctgacgagc atcacaaaaa

     7021 tcgacgctca agtcagaggt ggcgaaaccc gacaggacta taaagatacc aggcgtttcc

     7081 ccctggaagc tccctcgtgc gctctcctgt tccgaccctg ccgcttaccg gatacctgtc

     7141 cgcctttctc ccttcgggaa gcgtggcgct ttctcatagc tcacgctgta ggtatctcag

     7201 ttcggtgtag gtcgttcgct ccaagctggg ctgtgtgcac gaaccccccg ttcagcccga

     7261 ccgctgcgcc ttatccggta actatcgtct tgagtccaac ccggtaagac acgacttatc

     7321 gccactggca gcagccactg gtaacaggat tagcagagcg aggtatgtag gcggtgctac

     7381 agagttcttg aagtggtggc ctaactacgg ctacactaga agaacagtat ttggtatctg

     7441 cgctctgctg aagccagtta ccttcggaaa aagagttggt agctcttgat ccggcaaaca

     7501 aaccaccgct ggtagcggtt tttttgtttg caagcagcag attacgcgca gaaaaaaagg

     7561 atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagtgga acgaaaactc

     7621 acgttaaggg attttggtca tgagattatc aaaaaggatc ttcacctaga tccttttaaa

     7681 ttaaaaatga agttttaaat caatctaaag tatatatgag taaacttggt ctgacagtta

     7741 ccaatgctta atcagtgagg cacctatctc agcgatctgt ctatttcgtt catccatagt

     7801 tgcctgactc cccgtcgtgt agataactac gatacgggag ggcttaccat ctggccccag

     7861 tgctgcaatg ataccgcgag acccacgctc accggctcca gatttatcag caataaacca

     7921 gccagccgga agggccgagc gcagaagtgg tcctgcaact ttatccgcct ccatccagtc

     7981 tattaattgt tgccgggaag ctagagtaag tagttcgcca gttaatagtt tgcgcaacgt

     8041 tgttgccatt gctacaggca tcgtggtgtc acgctcgtcg tttggtatgg cttcattcag

     8101 ctccggttcc caacgatcaa ggcgagttac atgatccccc atgttgtgca aaaaagcggt

     8161 tagctccttc ggtcctccga tcgttgtcag aagtaagttg gccgcagtgt tatcactcat

     8221 ggttatggca gcactgcata attctcttac tgtcatgcca tccgtaagat gcttttctgt

     8281 gactggtgag tactcaacca agtcattctg agaatagtgt atgcggcgac cgagttgctc

     8341 ttgcccggcg tcaatacggg ataataccgc gccacatagc agaactttaa aagtgctcat

     8401 cattggaaaa cgttcttcgg ggcgaaaact ctcaaggatc ttaccgctgt tgagatccag

     8461 ttcgatgtaa cccactcgtg cacccaactg atcttcagca tcttttactt tcaccagcgt

     8521 ttctgggtga gcaaaaacag gaaggcaaaa tgccgcaaaa aagggaataa gggcgacacg

     8581 gaaatgttga atactcatac tcttcctttt tcaatattat tgaagcattt atcagggtta

     8641 ttgtctcatg agcggataca tatttgaatg tatttagaaa aataaacaaa taggggttcc

     8701 gcgcacattt ccccgaaaag tgccacctga cgtcgacgga tcgggagatc aacttgttta

     8761 ttgcagctta taatggttac aaataaagca atagcatcac aaatttcaca aataaagcat

     8821 ttttttcact gcattctagt tgtggtttgt ccaaactcat caatgtatct tatcatgtct

     8881 ggatcaactg gataactcaa gctaaccaaa atcatcccaa acttcccacc ccatacccta

     8941 ttaccactgc caattaccta gtggtttcat ttactctaaa cctgtgattc ctctgaatta

     9001 ttttcatttt aaagaaattg tatttgttaa atatgtacta caaacttagt agtttttaaa

     9061 gaaattgtat ttgttaaata tgtactacaa acttagtagt

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart