pLVX-EF1α-IRES-EGFP-PGK-Puro

$260.00

  • Model: PVT11071
  • 50 Units in Stock
Ask a question


Add to Cart:

pLVX-EF1α-IRES-EGFP-PGK-Puro

PVT11071   2ug

 

pLVX-EF1α-IRES-EGFP-PGK-Puro Informaiton

Prokaryotic resistance: ampicillin Amp

Screening marker: puromycin Puro, green fluorescent protein EGFP

Clone strain: Escherichia coli Stbl3

Culture conditions: LB medium, 37 C

 

pLVX-EF1α-IRES-EGFP-PGK-Puro Description

PLVX-EF1 -IRES-EGFP-PGK-Puro is a lentiviral expression plasmid.

 

pLVX-EF1α-IRES-EGFP-PGK-Puro Sequence

 

LOCUS       Exported               10166 bp ds-DNA     circular SYN 16-AUG-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..10166

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             1..634

                     /label=3' LTR

                     /note="3' long terminal repeat (LTR) from HIV-1"

     misc_feature    681..806

                     /label=HIV-1 Psi

                     /note="packaging signal of human immunodeficiency virus 

                     type 1"

     misc_feature    1303..1536

                     /label=RRE

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     misc_feature    2028..2143

                     /label=cPPT/CTS

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1 (lacking the first T)"

     promoter        2338..3519

                     /label=EF-1-alpha promoter

                     /note="strong constitutive promoter for human elongation 

                     factor EF-1-alpha"

     misc_feature    3563..4135

                     /label=IRES

                     /note="internal ribosome entry site (IRES) of the 

                     encephalomyocarditis virus (EMCV)"

     CDS             4167..4883

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     promoter        4916..5414

                     /label=PGK promoter

                     /note="mouse phosphoglycerate kinase 1 promoter"

     CDS             5474..6073

                     /codon_start=1

                     /gene="pac from Streptomyces alboniger"

                     /product="puromycin N-acetyltransferase"

                     /label=PuroR

                     /note="confers resistance to puromycin"

                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER

                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA

                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS

                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"

     misc_feature    6087..6675

                     /label=WPRE

                     /note="woodchuck hepatitis virus posttranscriptional 

                     regulatory element"

     LTR             6882..7515

                     /label=3' LTR

                     /note="3' long terminal repeat (LTR) from HIV-1"

     rep_origin      complement(8046..8634)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(8805..9665)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(9666..9770)

                     /gene="bla"

                     /label=AmpR promoter

     polyA_signal    9818..9952

                     /label=SV40 poly(A) signal

                     /note="SV40 polyadenylation signal"

ORIGIN

        1 tggaagggct aattcactcc caaagaagac aagatatcct tgatctgtgg atctaccaca

       61 cacaaggcta cttccctgat tagcagaact acacaccagg gccaggggtc agatatccac

      121 tgacctttgg atggtgctac aagctagtac cagttgagcc agataaggta gaagaggcca

      181 ataaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatgggatg gatgacccgg

      241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac gtggcccgag

      301 agctgcatcc ggagtacttc aagaactgct gatatcgagc ttgctacaag ggactttccg

      361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat

      421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga

      481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct

      541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc

      601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacttgaaag

      661 cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg

      721 caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga

      781 aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgcgatggg

      841 aaaaaattcg gttaaggcca gggggaaaga aaaaatataa attaaaacat atagtatggg

      901 caagcaggga gctagaacga ttcgcagtta atcctggcct gttagaaaca tcagaaggct

      961 gtagacaaat actgggacag ctacaaccat cccttcagac aggatcagaa gaacttagat

     1021 cattatataa tacagtagca accctctatt gtgtgcatca aaggatagag ataaaagaca

     1081 ccaaggaagc tttagacaag atagaggaag agcaaaacaa aagtaagacc accgcacagc

     1141 aagcggccgg ccgctgatct tcagacctgg aggaggagat atgagggaca attggagaag

     1201 tgaattatat aaatataaag tagtaaaaat tgaaccatta ggagtagcac ccaccaaggc

     1261 aaagagaaga gtggtgcaga gagaaaaaag agcagtggga ataggagctt tgttccttgg

     1321 gttcttggga gcagcaggaa gcactatggg cgcagcgtca atgacgctga cggtacaggc

     1381 cagacaatta ttgtctggta tagtgcagca gcagaacaat ttgctgaggg ctattgaggc

     1441 gcaacagcat ctgttgcaac tcacagtctg gggcatcaag cagctccagg caagaatcct

     1501 ggctgtggaa agatacctaa aggatcaaca gctcctgggg atttggggtt gctctggaaa

     1561 actcatttgc accactgctg tgccttggaa tgctagttgg agtaataaat ctctggaaca

     1621 gatttggaat cacacgacct ggatggagtg ggacagagaa attaacaatt acacaagctt

     1681 aatacactcc ttaattgaag aatcgcaaaa ccagcaagaa aagaatgaac aagaattatt

     1741 ggaattagat aaatgggcaa gtttgtggaa ttggtttaac ataacaaatt ggctgtggta

     1801 tataaaatta ttcataatga tagtaggagg cttggtaggt ttaagaatag tttttgctgt

     1861 actttctata gtgaatagag ttaggcaggg atattcacca ttatcgtttc agacccacct

     1921 cccaaccccg aggggacccg acaggcccga aggaatagaa gaagaaggtg gagagagaga

     1981 cagagacaga tccattcgat tagtgaacgg atctcgacgg tatcgccttt aaaagaaaag

     2041 gggggattgg ggggtacagt gcaggggaaa gaatagtaga cataatagca acagacatac

     2101 aaactaaaga attacaaaaa caaattacaa aaattcaaaa ttttcgggtt tattacaggg

     2161 acagcagaga tccagtttat cgatgagtaa ttcatacaaa aggactcgcc cctgccttgg

     2221 ggaatcccag ggaccgtcgt taaactccca ctaacgtaga acccagagat cgctgcgttc

     2281 ccgccccctc acccgcccgc tctcgtcatc actgaggtgg agaagagcat gcgtgaggct

     2341 ccggtgcccg tcagtgggca gagcgcacat cgcccacagt ccccgagaag ttggggggag

     2401 gggtcggcaa ttgaaccggt gcctagagaa ggtggcgcgg ggtaaactgg gaaagtgatg

     2461 tcgtgtactg gctccgcctt tttcccgagg gtgggggaga accgtatata agtgcagtag

     2521 tcgccgtgaa cgttcttttt cgcaacgggt ttgccgccag aacacaggta agtgccgtgt

     2581 gtggttcccg cgggcctggc ctctttacgg gttatggccc ttgcgtgcct tgaattactt

     2641 ccacgcccct ggctgcagta cgtgattctt gatcccgagc ttcgggttgg aagtgggtgg

     2701 gagagttcga ggccttgcgc ttaaggagcc ccttcgcctc gtgcttgagt tgaggcctgg

     2761 cttgggcgct ggggccgccg cgtgcgaatc tggtggcacc ttcgcgcctg tctcgctgct

     2821 ttcgataagt ctctagccat ttaaaatttt tgatgacctg ctgcgacgct ttttttctgg

     2881 caagatagtc ttgtaaatgc gggccaagat ctgcacactg gtatttcggt ttttggggcc

     2941 gcgggcggcg acggggcccg tgcgtcccag cgcacatgtt cggcgaggcg gggcctgcga

     3001 gcgcggccac cgagaatcgg acgggggtag tctcaagctg gccggcctgc tctggtgcct

     3061 ggcctcgcgc cgccgtgtat cgccccgccc tgggcggcaa ggctggcccg gtcggcacca

     3121 gttgcgtgag cggaaagatg gccgcttccc ggccctgctg cagggagctc aaaatggagg

     3181 acgcggcgct cgggagagcg ggcgggtgag tcacccacac aaaggaaaag ggcctttccg

     3241 tcctcagccg tcgcttcatg tgactccacg gagtaccggg cgccgtccag gcacctcgat

     3301 tagttctcga gcttttggag tacgtcgtct ttaggttggg gggaggggtt ttatgcgatg

     3361 gagtttcccc acactgagtg ggtggagact gaagttaggc cagcttggca cttgatgtaa

     3421 ttctccttgg aatttgccct ttttgagttt ggatcttggt tcattctcaa gcctcagaca

     3481 gtggttcaaa gtttttttct tccatttcag gtgtcgtgaa ccggtgcggc cgcataggat

     3541 ccagatctag attcaccggt cgcccctctc cctccccccc ccctaacgtt actggccgaa

     3601 gccgcttgga ataaggccgg tgtgcgtttg tctatatgtt attttccacc atattgccgt

     3661 cttttggcaa tgtgagggcc cggaaacctg gccctgtctt cttgacgagc attcctaggg

     3721 gtctttcccc tctcgccaaa ggaatgcaag gtctgttgaa tgtcgtgaag gaagcagttc

     3781 ctctggaagc ttcttgaaga caaacaacgt ctgtagcgac cctttgcagg cagcggaacc

     3841 ccccacctgg cgacaggtgc ctctgcggcc aaaagccacg tgtataagat acacctgcaa

     3901 aggcggcaca accccagtgc cacgttgtga gttggatagt tgtggaaaga gtcaaatggc

     3961 tcacctcaag cgtattcaac aaggggctga aggatgccca gaaggtaccc cattgtatgg

     4021 gatctgatct ggggcctcgg tgcacatgct ttacatgtgt ttagtcgagg ttaaaaaacg

     4081 tctaggcccc ccgaaccacg gggacgtggt tttcctttga aaaacacgat gataataccg

     4141 gtcgatccac aacctgtaca gccaccatgg tgagcaaggg cgaggagctg ttcaccgggg

     4201 tggtgcccat cctggtcgag ctggacggcg acgtaaacgg ccacaagttc agcgtgtccg

     4261 gcgagggcga gggcgatgcc acctacggca agctgaccct gaagttcatc tgcaccaccg

     4321 gcaagctgcc cgtgccctgg cccaccctcg tgaccaccct gacctacggc gtgcagtgct

     4381 tcagccgcta ccccgaccac atgaagcagc acgacttctt caagtccgcc atgcccgaag

     4441 gctacgtcca ggagcgcacc atcttcttca aggacgacgg caactacaag acccgcgccg

     4501 aggtgaagtt cgagggcgac accctggtga accgcatcga gctgaagggc atcgacttca

     4561 aggaggacgg caacatcctg gggcacaagc tggagtacaa ctacaacagc cacaacgtct

     4621 atatcatggc cgacaagcag aagaacggca tcaaggtgaa cttcaagatc cgccacaaca

     4681 tcgaggacgg cagcgtgcag ctcgccgacc actaccagca gaacaccccc atcggcgacg

     4741 gccccgtgct gctgcccgac aaccactacc tgagcaccca gtccgccctg agcaaagacc

     4801 ccaacgagaa gcgcgatcac atggtcctgc tggagttcgt gaccgccgcc gggatcactc

     4861 tcggcatgga cgagctgtac aaggaattct aatctagaac gcgattaatt ctaccgggta

     4921 ggggaggcgc ttttcccaag gcagtctgga gcatgcgctt tagcagcccc gctgggcact

     4981 tggcgctaca caagtggcct ctggcctcgc acacattcca catccaccgg taggcgccaa

     5041 ccggctccgt tctttggtgg ccccttcgcg ccaccttcta ctcctcccct agtcaggaag

     5101 ttcccccccg ccccgcagct cgcgtcgtgc aggacgtgac aaatggaagt agcacgtctc

     5161 actagtctcg tgcagatgga cagcaccgct gagcaatgga agcgggtagg cctttggggc

     5221 agcggccaat agcagctttg ctccttcgct ttctgggctc agaggctggg aaggggtggg

     5281 tccgggggcg ggctcagggg cgggctcagg ggcggggcgg gcgcccgaag gtcctccgga

     5341 ggcccggcat tctgcacgct tcgaagcgca cgtctgccgc gctgttctcc tcttcctcat

     5401 ctccgggcct ttcgaattca agggcagagg aagtcttcta acttgaggtg acgtggagga

     5461 gaatcccggc cctatgaccg agtacaagcc cacggtgcgc ctcgccaccc gcgacgacgt

     5521 ccccagggcc gtacgcaccc tcgccgccgc gttcgccgac taccccgcca cgcgccacac

     5581 cgtcgatccg gaccgccaca tcgagcgggt caccgagctg caagaactct tcctcacgcg

     5641 cgtcgggctc gacatcggca aggtgtgggt cgcggacgac ggcgccgcgg tggcggtctg

     5701 gaccacgccg gagagcgtcg aagcgggggc ggtgttcgcc gagatcggcc cgcgcatggc

     5761 cgagttgagc ggttcccggc tggccgcgca gcaacagatg gaaggcctcc tggcgccgca

     5821 ccggcccaag gagcccgcgt ggttcctggc caccgtcggc gtctcgcccg accaccaggg

     5881 caagggtctg ggcagcgccg tcgtgctccc cggagtggag gcggccgagc gcgccggggt

     5941 gcccgccttc ctggagacct ccgcgccccg caacctcccc ttctacgagc ggctcggctt

     6001 caccgtcacc gccgacgtcg aggtgcccga aggaccgcgc acctggtgca tgacccgcaa

     6061 gcccggtgcc tgaccgcgtc tggaacaatc aacctctgga ttacaaaatt tgtgaaagat

     6121 tgactggtat tcttaactat gttgctcctt ttacgctatg tggatacgct gctttaatgc

     6181 ctttgtatca tgctattgct tcccgtatgg ctttcatttt ctcctccttg tataaatcct

     6241 ggttgctgtc tctttatgag gagttgtggc ccgttgtcag gcaacgtggc gtggtgtgca

     6301 ctgtgtttgc tgacgcaacc cccactggtt ggggcattgc caccacctgt cagctccttt

     6361 ccgggacttt cgctttcccc ctccctattg ccacggcgga actcatcgcc gcctgccttg

     6421 cccgctgctg gacaggggct cggctgttgg gcactgacaa ttccgtggtg ttgtcgggga

     6481 agctgacgtc ctttccatgg ctgctcgcct gtgttgccac ctggattctg cgcgggacgt

     6541 ccttctgcta cgtcccttcg gccctcaatc cagcggacct tccttcccgc ggcctgctgc

     6601 cggctctgcg gcctcttccg cgtcttcgcc ttcgccctca gacgagtcgg atctcccttt

     6661 gggccgcctc cccgcctgga attaattctg cagtcgagac ctagaaaaac atggagcaat

     6721 cacaagtagc aatacagcag ctaccaatgc tgattgtgcc tggctagaag cacaagagga

     6781 ggaggaggtg ggttttccag tcacacctca ggtaccttta agaccaatga cttacaaggc

     6841 agctgtagat cttagccact ttttaaaaga aaagagggga ctggaagggc taattcactc

     6901 ccaacgaaga caagatatcc ttgatctgtg gatctaccac acacaaggct acttccctga

     6961 ttagcagaac tacacaccag ggccaggggt cagatatcca ctgacctttg gatggtgcta

     7021 caagctagta ccagttgagc cagataaggt agaagaggcc aataaaggag agaacaccag

     7081 cttgttacac cctgtgagcc tgcatgggat ggatgacccg gagagagaag tgttagagtg

     7141 gaggtttgac agccgcctag catttcatca cgtggcccga gagctgcatc cggagtactt

     7201 caagaactgc tgatatcgag cttgctacaa gggactttcc gctggggact ttccagggag

     7261 gcgtggcctg ggcgggactg gggagtggcg agccctcaga tcctgcatat aagcagctgc

     7321 tttttgcctg tactgggtct ctctggttag accagatctg agcctgggag ctctctggct

     7381 aactagggaa cccactgctt aagcctcaat aaagcttgcc ttgagtgctt caagtagtgt

     7441 gtgcccgtct gttgtgtgac tctggtaact agagatccct cagacccttt tagtcagtgt

     7501 ggaaaatctc tagcagtagt agttcatgtc atcttattat tcagtattta taacttgcaa

     7561 agaaatgaat atcagagagt gagaggcctt gacattgcta gcgttttacc gtcgacctct

     7621 agctagagct tggcgtaatc atggtcatag ctgtttcctg tgtgaaattg ttatccgctc

     7681 acaattccac acaacatacg agccggaagc ataaagtgta aagcctgggg tgcctaatga

     7741 gtgagctaac tcacattaat tgcgttgcgc tcactgcccg ctttccagtc gggaaacctg

     7801 tcgtgccagc tgcattaatg aatcggccaa cgcgcgggga gaggcggttt gcgtattggg

     7861 cgctcttccg cttcctcgct cactgactcg ctgcgctcgg tcgttcggct gcggcgagcg

     7921 gtatcagctc actcaaaggc ggtaatacgg ttatccacag aatcagggga taacgcagga

     7981 aagaacatgt gagcaaaagg ccagcaaaag gccaggaacc gtaaaaaggc cgcgttgctg

     8041 gcgtttttcc ataggctccg cccccctgac gagcatcaca aaaatcgacg ctcaagtcag

     8101 aggtggcgaa acccgacagg actataaaga taccaggcgt ttccccctgg aagctccctc

     8161 gtgcgctctc ctgttccgac cctgccgctt accggatacc tgtccgcctt tctcccttcg

     8221 ggaagcgtgg cgctttctca tagctcacgc tgtaggtatc tcagttcggt gtaggtcgtt

     8281 cgctccaagc tgggctgtgt gcacgaaccc cccgttcagc ccgaccgctg cgccttatcc

     8341 ggtaactatc gtcttgagtc caacccggta agacacgact tatcgccact ggcagcagcc

     8401 actggtaaca ggattagcag agcgaggtat gtaggcggtg ctacagagtt cttgaagtgg

     8461 tggcctaact acggctacac tagaagaaca gtatttggta tctgcgctct gctgaagcca

     8521 gttaccttcg gaaaaagagt tggtagctct tgatccggca aacaaaccac cgctggtagc

     8581 ggtggttttt ttgtttgcaa gcagcagatt acgcgcagaa aaaaaggatc tcaagaagat

     8641 cctttgatct tttctacggg gtctgacgct cagtggaacg aaaactcacg ttaagggatt

     8701 ttggtcatga gattatcaaa aaggatcttc acctagatcc ttttaaatta aaaatgaagt

     8761 tttaaatcaa tctaaagtat atatgagtaa acttggtctg acagttacca atgcttaatc

     8821 agtgaggcac ctatctcagc gatctgtcta tttcgttcat ccatagttgc ctgactcccc

     8881 gtcgtgtaga taactacgat acgggagggc ttaccatctg gccccagtgc tgcaatgata

     8941 ccgcgagacc cacgctcacc ggctccagat ttatcagcaa taaaccagcc agccggaagg

     9001 gccgagcgca gaagtggtcc tgcaacttta tccgcctcca tccagtctat taattgttgc

     9061 cgggaagcta gagtaagtag ttcgccagtt aatagtttgc gcaacgttgt tgccattgct

     9121 acaggcatcg tggtgtcacg ctcgtcgttt ggtatggctt cattcagctc cggttcccaa

     9181 cgatcaaggc gagttacatg atcccccatg ttgtgcaaaa aagcggttag ctccttcggt

     9241 cctccgatcg ttgtcagaag taagttggcc gcagtgttat cactcatggt tatggcagca

     9301 ctgcataatt ctcttactgt catgccatcc gtaagatgct tttctgtgac tggtgagtac

     9361 tcaaccaagt cattctgaga atagtgtatg cggcgaccga gttgctcttg cccggcgtca

     9421 atacgggata ataccgcgcc acatagcaga actttaaaag tgctcatcat tggaaaacgt

     9481 tcttcggggc gaaaactctc aaggatctta ccgctgttga gatccagttc gatgtaaccc

     9541 actcgtgcac ccaactgatc ttcagcatct tttactttca ccagcgtttc tgggtgagca

     9601 aaaacaggaa ggcaaaatgc cgcaaaaaag ggaataaggg cgacacggaa atgttgaata

     9661 ctcatactct tcctttttca atattattga agcatttatc agggttattg tctcatgagc

     9721 ggatacatat ttgaatgtat ttagaaaaat aaacaaatag gggttccgcg cacatttccc

     9781 cgaaaagtgc cacctgacgt cgacggatcg ggagatcaac ttgtttattg cagcttataa

     9841 tggttacaaa taaagcaata gcatcacaaa tttcacaaat aaagcatttt tttcactgca

     9901 ttctagttgt ggtttgtcca aactcatcaa tgtatcttat catgtctgga tcaactggat

     9961 aactcaagct aaccaaaatc atcccaaact tcccacccca taccctatta ccactgccaa

    10021 ttacctgtgg tttcatttac tctaaacctg tgattcctct gaattatttt cattttaaag

    10081 aaattgtatt tgttaaatat gtactacaaa cttagtagtt tttaaagaaa ttgtatttgt

    10141 taaatatgta ctacaaactt agtagt

//

 

Caution:
1.  This product is FOR RESEARCH USE ONLY!
2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart