pLysS Plasmid

$136.00

  • Model: PVT5702
  • 50 Units in Stock
Ask a question


Add to Cart:

pLysS

Search name

pLysS,Plasmid pLysS,pLysS vector

 

pLysS Information

Promoter: T7 Phi-3.8

Replicon: p15 ori

Plasmid classification: toxic protein expression plasmid

Plasmid size: 4886bp

Plasmid tagging: T7 lysozyme

Prokaryotic resistance: chloramphenicol Chloramphenicol

Clonal strain: DH5 alpha

Culture conditions: 37 C, aerobic, LB

Expression host: Escherichia coli

Culture conditions: refer to relevant literature.

5'sequencing primers: Based on sequence design

3'sequencing primers: Based on sequence design

Remarks: low copy

 

pLysS Description

pLysS and pLysE are 4886bp plasmids constructed by insertion of the T7 lysozyme gene into the BamH I site of pACYC184 (1, 2). These plasmids are not cloning vectors; they are used in λDE3 lysogenic hosts to suppress basal expression from the T7 promoter by producing T7 lysozyme, a natural inhibitor of T7 RNA polymerase. The two plasmids differ only by the orientation of the T7 lysozyme gene. In pLysS the T7 lysozyme coding sequence is in the antisense orientation relative to the tet promoter, so only a small amount of T7 lysozyme is produced. In pLysE large amounts of T7 lysozyme are produced from the tet promoter. The construct also contains the weak T7 φ3.8 promoter immediately following the lysozyme gene. The p15A origin of replication is compatible with those found in pBR322- and pUC-derived plasmids.Unique sites are shown on the circle map.
        1. Studier , F.W. (1991) J. Mol. Biol. 219, 37-44.
        2. Chang, A.C.Y. and Cohen, S.N. (1978) J. Bacteriol. 134, 1141.

 

pLysS Multiple cloning site

pLysS-vector

 

 

pLysS Sequence

LOCUS       Exported                4886 bp ds-DNA     circular SYN 10-SEP-2016
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    pLysS
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4886)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Saturday, September 10, 2016 from SnapGene Viewer 3.1.4
FEATURES             Location/Qualifiers
     source          1..4886
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        complement(220..322)
                     /note="cat promoter"
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     rep_origin      complement(848..1392)
                     /direction=LEFT
                     /note="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        1504..1532
                     /note="tet promoter"
                     /note="E. coli promoter for tetracycline efflux protein 
                     gene"
     promoter        complement(1981..2014)
                     /note="T7 Phi-3.8 promoter"
                     /note="weak promoter for bacteriophage T7 RNA polymerase"
     CDS             complement(2012..2467)
                     /codon_start=1
                     /product="lysozyme from bacteriophage T7"
                     /note="T7 lysozyme"
                     /note="inhibitor of T7 RNA polymerase"
                     /translation="MARVQFKQRESTDAIFVHCSATKPSQNVGVREIRQWHKEQGWLDV
                     GYHFIIKRDGTVEAGRDEMAVGSHAKGYNHNSIGVCLVGGIDDKGKFDANFTPAQMQSL
                     RSLLVTLLAKYEGAGLRAHHEVAPKACPSFDLKRWWEKNELVTSDRG"
     CDS             complement(4446..219)
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
ORIGIN
        1 gaattccgga tgagcattca tcaggcgggc aagaatgtga ataaaggccg gataaaactt
       61 gtgcttattt ttctttacgg tctttaaaaa ggccgtaata tccagctgaa cggtctggtt
      121 ataggtacat tgagcaactg actgaaatgc ctcaaaatgt tctttacgat gccattggga
      181 tatatcaacg gtggtatatc cagtgatttt tttctccatt ttagcttcct tagctcctga
      241 aaatctcgat aactcaaaaa atacgcccgg tagtgatctt atttcattat ggtgaaagtt
      301 ggaacctctt acgtgccgat caacgtctca ttttcgccaa aagttggccc agggcttccc
      361 ggtatcaaca gggacaccag gatttattta ttctgcgaag tgatcttccg tcacaggtat
      421 ttattcggcg caaagtgcgt cgggtgatgc tgccaactta ctgatttagt gtatgatggt
      481 gtttttgagg tgctccagtg gcttctgttt ctatcagctg tccctcctgt tcagctactg
      541 acggggtggt gcgtaacggc aaaagcaccg ccggacatca gcgctagcgg agtgtatact
      601 ggcttactat gttggcactg atgagggtgt cagtgaagtg cttcatgtgg caggagaaaa
      661 aaggctgcac cggtgcgtca gcagaatatg tgatacagga tatattccgc ttcctcgctc
      721 actgactcgc tacgctcggt cgttcgactg cggcgagcgg aaatggctta cgaacggggc
      781 ggagatttcc tggaagatgc caggaagata cttaacaggg aagtgagagg gccgcggcaa
      841 agccgttttt ccataggctc cgcccccctg acaagcatca cgaaatctga cgctcaaatc
      901 agtggtggcg aaacccgaca ggactataaa gataccaggc gtttcccctg gcggctccct
      961 cgtgcgctct cctgttcctg cctttcggtt taccggtgtc attccgctgt tatggccgcg
     1021 tttgtctcat tccacgcctg acactcagtt ccgggtaggc agttcgctcc aagctggact
     1081 gtatgcacga accccccgtt cagtccgacc gctgcgcctt atccggtaac tatcgtcttg
     1141 agtccaaccc ggaaagacat gcaaaagcac cactggcagc agccactggt aattgattta
     1201 gaggagttag tcttgaagtc atgcgccggt taaggctaaa ctgaaaggac aagttttggt
     1261 gactgcgctc ctccaagcca gttacctcgg ttcaaagagt tggtagctca gagaaccttc
     1321 gaaaaaccgc cctgcaaggc ggttttttcg ttttcagagc aagagattac gcgcagacca
     1381 aaacgatctc aagaagatca tcttattaat cagataaaat atttctagat ttcagtgcaa
     1441 tttatctctt caaatgtagc acctgaagtc agccccatac gatataagtt gtaattctca
     1501 tgtttgacag cttatcatcg ataagcttta atgcggtagt ttatcacagt taaattgcta
     1561 acgcagtcag gcaccgtgta tgaaatctaa caatgcgctc atcgtcatcc tcggcaccgt
     1621 caccctggat gctgtaggca taggcttggt tatgccggta ctgccgggcc tcttgcggga
     1681 tatcgtccat tccgacagca tcgccagtca ctatggcgtg ctgctagcgc tatatgcgtt
     1741 gatgcaattt ctatgcgcac ccgttctcgg agcactgtcc gaccgctttg gccgccgccc
     1801 agtcctgctc gcttcgctac ttggagccac tatcgactac gcgatcatgg cgaccacacc
     1861 cgtcctgtgg atccggccca ttggctgcct cccacacttg gatatgcctc ctcggagcct
     1921 tatagaattg tttataagac ttgcgcatta tttgacctcc aatgcgaaca aagggaaacc
     1981 gctgtggtct ccctttagtg agttcaatta attatccacg gtcagaagtg accagttcgt
     2041 tcttctccca ccaacgctta aggtcgaacg aagggcaagc cttcggcgcc acctcatgat
     2101 gggcgcgaag accagcgcct tcgtacttag ccagcagtgt gacaagcagt gagcgaaggg
     2161 attgcatttg ggctggcgta aagttagcgt cgaacttacc tttatcgtcg ataccaccaa
     2221 caaggcagac gccgatagag ttgtggttgt aacccttagc gtgagagcct acagccatct
     2281 catctcgtcc tgcctccaca gtaccgtctc gcttgatgat aaagtggtat cccacatcga
     2341 gccaaccctg ctctttgtgc cactggcgaa tctcacggac accaacattc tgacttggct
     2401 tggtagccga gcagtgaaca aagattgcgt cagtagattc acgttgttta aactgtacac
     2461 gagccattat ttctttcctc ctttcctttt taatctatca aaggggaccc ggatcctcta
     2521 cgccggacgc atcgtggccg gcatcaccgg cgccacaggt gcggttgctg gcgcctatat
     2581 cgccgacatc accgatgggg aagatcgggc tcgccacttc gggctcatga gcgcttgttt
     2641 cggcgtgggt atggtggcag gccccgtggc cgggggactg ttgggcgcca tctccttgca
     2701 tgcaccattc cttgcggcgg cggtgctcaa cggcctcaac ctactactgg gctgcttcct
     2761 aatgcaggag tcgcataagg gagagcgtcg accgatgccc ttgagagcct tcaacccagt
     2821 cagctccttc cggtgggcgc ggggcatgac tatcgtcgcc gcacttatga ctgtcttctt
     2881 tatcatgcaa ctcgtaggac aggtgccggc agcgctctgg gtcattttcg gcgaggaccg
     2941 ctttcgctgg agcgcgacga tgatcggcct gtcgcttgcg gtattcggaa tcttgcacgc
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart