pMA5

$396.00

  • Model: PVT5011
  • 50 Units in Stock
Ask a question


Add to Cart:

pMA5

PVT5011    2ug
 

pMA5 information

Promoter: HpaII promoter
Replicator: ColE1 Ori, F1 Ori
Plasmid classification: Bacillus subtilis plasmids; free plasmids of withered grass; plasmids in withered grass
Plasmid size: 7202bp
Prokaryotic resistance: ampicillin Amp
Cloned strains of Escherichia coli, DH5 A and other Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Use: Bacillus subtilis

pMA5 Sequence

LOCUS       Exported                7202 bp ds-DNA    circular SYN 08-SEP-2017

KEYWORDS    pMA5

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 7202)

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..7202

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      429..884

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        1006..1110

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             1111..1971

                     /codon_start=1

                     /note="Amp"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      2142..2733

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number colE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    5317..6078

                     /note="Kan"

     misc_feature    6934..3

                     /note="HpaII promoter"

ORIGIN

        1 catatgagtt atgcagtttg tagaatgcaa aaagtgaaat cagggggatc ctctagagtc

       61 gagctcaagc tagcttggta cgtaccagat ctgagatcac gcgttctaga ggtcgaaatt

      121 cacctcgaaa gcaagctgat aaaccgatac aattaaaggc tccttttgga gccttttttt

      181 ttggagattt tcaacgtgaa aaaattatta ttcgcaattc caagctaatt cacctcgaaa

      241 gcaagctgat aaaccgatac aattaaaggc tccttttgga gccttttttt ttggagattt

      301 tcaacgtgaa aaaattatta ttcgcaattc caagctctgc ctcgcgcgtt tcggtgatga

      361 cggtgaaaac ctctgacaca tgcagctccc ggagacggtc acagcttgtc tgtaagcgga

      421 tgcagatcac gcgccctgta gcggcgcatt aagcgcggcg ggtgtggtgg ttacgcgcag

      481 cgtgaccgct acacttgcca gcgccctagc gcccgctcct ttcgctttct tcccttcctt

      541 tctcgccacg ttcgccggct ttccccgtca agctctaaat cgggggctcc ctttagggtt

      601 ccgatttagt gctttacggc acctcgaccc caaaaaactt gattagggtg atggttcacg

      661 tagtgggcca tcgccctgat agacggtttt tcgccctttg acgttggagt ccacgttctt

      721 taatagtgga ctcttgttcc aaactggaac aacactcaac cctatctcgg tctattcttt

      781 tgatttataa gggattttgc cgatttcggc ctattggtta aaaaatgagc tgatttaaca

      841 aaaatttaac gcgaatttta acaaaatatt aacgcttaca atttgatctg cgctcggtcg

      901 ttcggctgcg gcgagcggta tcagctcact caaagcggta atacggttat cccagaatcc

      961 ggggataacg caggaaagac aggtggcact tttcggggaa atgtgcgcgg aacccctatt

     1021 tgtttatttt tctaaataca ttcaaatatg tatccgctca tgagacaata accctgataa

     1081 atgcttcaat aatattgaaa aaggaagagt atgagtattc aacatttccg tgtcgccctt

     1141 attccctttt ttgcggcatt ttgccttcct gtttttgctc acccagaaac gctggtgaaa

     1201 gtaaaagatg ctgaagatca gttgggtgca cgagtgggtt acatcgaact ggatctcaac

     1261 agcggtaaga tccttgagag ttttcgcccc gaagaacgtt ttccaatgat gagcactttt

     1321 aaagttctgc tatgtggcgc ggtattatcc cgtgttgacg ccgggcaaga gcaactcggt

     1381 cgccgcatac actattctca gaatgacttg gttgagtact caccagtcac agaaaagcat

     1441 cttacggatg gcatgacagt aagagaatta tgcagtgctg ccataaccat gagtgataac

     1501 actgcggcca acttacttct gacaacgatc ggaggaccga aggagctaac cgcttttttg

     1561 cacaacatgg gggatcatgt aactcgcctt gatcgttggg aaccggagct gaatgaagcc

     1621 ataccaaacg acgagcgtga caccacgatg cctgcagcaa tggcaacaac gttgcgcaaa

     1681 ctattaactg gcgaactact tactctagct tcccggcaac aattaataga ctggatggag

     1741 gcggataaag ttgcaggacc acttctgcgc tcggcccttc cggctggctg gtttattgct

     1801 gataaatctg gagccggtga gcgtgggtct cgcggtatca ttgcagcact ggggccagat

     1861 ggtaagccct cccgtatcgt agttatctac acgacgggga gtcaggcaac tatggatgaa

     1921 cgaaatagac agatcgctga gataggtgcc tcactgatta agcattggta actgtcagac

     1981 caagtttact catatatact ttagattgat ttaaaacttc atttttaatt taaaaggatc

     2041 taggtgaaga tcctttttga taatctcatg accaaaatcc cttaacgtga gttttcgttc

     2101 cactgagcgt cagaccccgt agaaaagatc aaaggatctt cttgagatcc tttttttctg

     2161 cgcgtaatct gctgcttgca aacaaaaaaa ccaccgctac cagcggtggt ttgtttgccg

     2221 gatcaagagc taccaactct ttttccgaag gtaactggct tcagcagagc gcagatacca

     2281 aatactgtcc ttctagtgta gccgtagtta ggccaccact tcaagaactc tgtagcaccg

     2341 cctacatacc tcgctctgct aatcctgtta ccagtggctg ctgccagtgg cgataagtcg

     2401 tgtcttaccg ggttggactc aagacgatag ttaccggata aggcgcagcg gtcgggctga

     2461 acggggggtt cgtgcacaca gcccagcttg gagcgaacga cctacaccga agtactgaga

     2521 tacctacagc gtgagctatg agaaagcgcc acgcttcccg aagggagaaa ggcggacagg

     2581 tatccggtaa gcggcagggt cggaacagga gagcgcacga gggagcttcc agggggaaac

     2641 gcctggtatc tttatagtcc tgtcgggttt cgccacctct gacttgagcg tcgatttttg

     2701 tgatgctcgt caggggggcg gagcctatgg aaaaacgcca gcaacgcggc ctttttacgg

     2761 ttcctggcct tttgctggcc ttttgctcac atgttctttc ctgcgttatc ccctgattct

     2821 gtggataacc gtattaccgc ctttgagtga gctgataccg ctcgccgcag ccgaacgacc

     2881 gagcgcagcg agtcagtgag cgaggaagcg gaagagcgcc caatacgcaa accgcctctc

     2941 cccgcgcgtt ggccgattca ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg

     3001 ggcagtgagc gcaacgcaat taatgtgagt tagctcactc attaggcacc ccaggcttta

     3061 cactttatgc ttccggcata ttctcaataa accctttagg gaaataggcc aggttttcac

     3121 cgtaacacgc cacatcttgc gaatatatgt gtagaaactg ccggaaatcg tcgtggtatt

     3181 cactccagag cgatgaaaac gtttcagttt gctcatggaa aacggtgtaa caagggtgaa

     3241 cactatccca tatcaccagc tcaccgtctt tcattgccat acgaaattcc ggatgagcat

     3301 tcatcaggcg ggcaagaatg tgaataaagg ccggataaaa cttgtgctta tttttcttta

     3361 cggtctttaa aaaggccgta atatccagct aaacggtctg gttataggta cattgagcaa

     3421 ctgactgaaa tgcctcaaaa tgttctttac gatgccattg ggatatatca acggtggtat

     3481 atccagtgat ttttttctcc attttagctt ccttagctcc tgaaaatctc gataactcaa

     3541 aaaatacgcc cggtagtgat cttatttcat tatggtgaaa gttggaacct cttacgtgcc

     3601 gatcaacgtc tcattttcgc caaaagttgg cccagggctt cccggtatca acagggacac

     3661 caggatttat ttattctgcg aagtgatctt ccgtcacagg tatttattcg aagacgaaag

     3721 ggcatcgcgc gcggggaatt cccgggagag ctcgatatcg catgcggtac ctctagaaga

     3781 agcttggaga caaggtaaag gataaaacag cacaattcca agaaaaacac gatttagaac

     3841 ctaaaaagaa cgaatttgaa ctaactcata accgagaggt aaaaaaagaa cgaagtcgag

     3901 atcagggaat gagtttataa aataaaaaaa gcacctgaaa aggtgtcttt ttttgatggt

     3961 tttgaacttg ttctttctta tcttgataca tatagaaata acgtcatttt tattttagtt

     4021 gctgaaaggt gcgttgaagt gttggtatgt atgtgtttta aagtattgaa aacccttaaa

     4081 attggttgca cagaaaaacc ccatctgtta aagttataag tgactaaaca aataactaaa

     4141 tagatggggg tttcttttaa tattatgtgt cctaatagta gcatttattc agatgaaaaa

     4201 tcaagggttt tagtggacaa gacaaaaagt ggaaaagtga gaccatggag agaaaagaaa

     4261 atcgctaatg ttgattactt tgaacttctg catattcttg aatttaaaaa ggctgaaaga

     4321 gtaaaagatt gtgctgaaat attagagtat aaacaaaatc gtgaaacagg cgaaagaaag

     4381 ttgtatcgag tgtggttttg taaatccagg ctttgtccaa tgtgcaactg gaggagagca

     4441 atgaaacatg gcattcagtc acaaaaggtt gttgctgaag ttattaaaca aaagccaaca

     4501 gttcgttggt tgtttctcac attaacagtt aaaaatgttt atgatggcga agaattaaat

     4561 aagagtttgt cagatatggc tcaaggattt cgccgaatga tgcaatataa aaaaattaat

     4621 aaaaatcttg ttggttttat gcgtgcaacg gaagtgacaa taaataataa agataattct

     4681 tataatcagc acatgcatgt attggtatgt gtggaaccaa cttattttaa gaatacagaa

     4741 aactacgtga atcaaaaaca atggattcaa ttttggaaaa aggcaatgaa attagactat

     4801 gatccaaatg taaaagttca aatgattcga ccgaaaaata aatataaatc ggatatacaa

     4861 tcggcaattg acgaaactgc aaaatatcct gtaaaggata cggattttat gaccgatgat

     4921 gaagaaaaga atttgaaacg tttgtctgat ttggaggaag gtttacaccg taaaaggtta

     4981 atctcctatg gtggtttgtt aaaagaaata cataaaaaat taaaccttga tgacacagaa

     5041 gaaggcgatt tgattcatac agatgatgac gaaaaagccg atgaagatgg attttctatt

     5101 attgcaatgt ggaattggga acggaaaaat tattttatta aagagtagtt caacaaacgg

     5161 gccagtttgt tgaagattag atgctataat tgttattaaa aggattgaag gatgcttagg

     5221 aagacgagtt attaatagct gaataagaac ggtgctctcc aaatattctt atttagaaaa

     5281 gcaaatctaa aattatctga aaagggaatg agaatagtga atggaccaat aataatgact

     5341 agagaagaaa gaatgaagat tgttcatgaa attaaggaac gaatattgga taaatatggg

     5401 gatgatgtta aggctattgg tgtttatggc tctcttggtc gtcagactga tgggccctat

     5461 tcggatattg agatgatgtg tgtcatgtca acagaggaag cagagttcag ccatgaatgg

     5521 acaaccggtg agtggaaggt ggaagtgaat tttgatagcg aagagattct actagattat

     5581 gcatctcagg tggaatcaga ttggccgctt acacatggtc aatttttctc tattttgccg

     5641 atttatgatt caggtggata cttagagaaa gtgtatcaaa ctgctaaatc ggtagaagcc

     5701 caaacgttcc acgatgcgat ttgtgccctt atcgtagaag agctgtttga atatgcaggc

     5761 aaatggcgta atattcgtgt gcaaggaccg acaacatttc taccatcctt gactgtacag

     5821 gtagcaatgg caggtgccat gttgattggt ctgcatcatc gcatctgtta tacgacgagc

     5881 gcttcggtct taactgaagc agttaagcaa tcagatcttc cttcaggtta tgaccatctg

     5941 tgccagttcg taatgtctgg tcaactttcc gactctgaga aacttctgga atcgctagag

     6001 aatttctgga atgggattca ggagtggaca gaacgacacg gatatatagt ggatgtgtca

     6061 aaacgcatac cattttgaac gatgacctct aataattgtt aatcatgttg gttacgtatt

     6121 tattaacttc tcctagtatt agtaattatc atggctgtca tggcgcatta acggaataaa

     6181 gggtgtgctt aaatcgggcc attttgcgta ataagaaaaa ggattaatta tgagcgaatt

     6241 gaattaataa taaggtaata gatttacatt agaaaatgaa aggggatttt atgcgtgaga

     6301 atgttacagt ctatcccggc attgccagtc ggggatatta aaaagagtat aggtttttat

     6361 tgcgataaac taggtttcac tttggttcac catgaagatg gattcgcagt tctaatgtgt

     6421 aatgaggttc ggattcatct atgggaggca agtgatgaag gctggcgctc tcgtagtaat

     6481 gattcaccgg tttgtacagg tgcggagtcg tttattgctg gtactgctag ttgccgcatt

     6541 gaagtagagg gaattgatga attatatcaa catattaagc ctttgggcat tttgcacccc

     6601 aatacatcat taaaagatca gtggtgggat gaacgagact ttgcagtaat tgatcccgac

     6661 aacaatttga ttagcttttt tcaacaaata aaaagctaaa atctattatt aatctgttca

     6721 gcaatcgggc gcgattgctg aataaaagat acgagagacc tctcttgtat cttttttatt

     6781 ttgagtggtt ttgtccgtta cactagaaaa ccgaaagaca ataaaaattt tattcttgct

     6841 gagtctggct ttcggtaagc tagacaaaac ggacaaaata aaaattggca agggtttaaa

     6901 ggtggagatt ttttgagtga tcttctcaaa aaatactacc tgtcccttgc tgatttttaa

     6961 acgagcacga gagcaaaacc cccctttgct gaggtggcag agggcaggtt tttttgtttc

     7021 ttttttctcg taaaaaaaag aaaggtctta aaggttttat ggttttggtc ggcactgccg

     7081 acagcctcgc agagcacaca ctttatgaat ataaagtata gtgtgttata ctttacttgg

     7141 aagtggttgc cggaaagagc gaaaatgcct cacatttgtg ccacctaaaa aggagcgatt

     7201 ta

//

 

Caution:
Product is for research use only!

 

 

Search name

pMA5,Plasmid pMA5,pMA5 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart