pMA5 Plasmid

$396.00

  • Model: PVT5011
  • 50 Units in Stock
Ask a question


Add to Cart:

pMA5

Search name

pMA5,Plasmid pMA5,pMA5 vector

pMA5 plasmid information

Promoter: HpaII promoter
Replicator: ColE1 Ori, F1 Ori
Plasmid classification: Bacillus subtilis plasmids; free plasmids of withered grass; plasmids in withered grass
Plasmid size: 7202bp
Prokaryotic resistance: ampicillin Amp
Cloned strains of Escherichia coli, DH5 A and other Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Use: Bacillus subtilis

pMA5 plasmid Sequence
 

LOCUS       Exported                7202 bp ds-DNA 
KEYWORDS    pMA5
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7202)
  TITLE     Direct Submission
           
FEATURES             Location/Qualifiers
     source          1..7202
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      429..884
                     /direction=RIGHT
                     /note="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        1006..1110
                     /gene="bla"
                     /note="AmpR promoter"
     CDS             1111..1971
                     /codon_start=1
                     /note="Amp"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     rep_origin      2142..2733
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number colE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    5317..6078
                     /note="Kan"
     misc_feature    6934..3
                     /note="HpaII promoter"
ORIGIN
        1 catatgagtt atgcagtttg tagaatgcaa aaagtgaaat cagggggatc ctctagagtc
       61 gagctcaagc tagcttggta cgtaccagat ctgagatcac gcgttctaga ggtcgaaatt
      121 cacctcgaaa gcaagctgat aaaccgatac aattaaaggc tccttttgga gccttttttt
      181 ttggagattt tcaacgtgaa aaaattatta ttcgcaattc caagctaatt cacctcgaaa
      241 gcaagctgat aaaccgatac aattaaaggc tccttttgga gccttttttt ttggagattt
      301 tcaacgtgaa aaaattatta ttcgcaattc caagctctgc ctcgcgcgtt tcggtgatga
      361 cggtgaaaac ctctgacaca tgcagctccc ggagacggtc acagcttgtc tgtaagcgga
      421 tgcagatcac gcgccctgta gcggcgcatt aagcgcggcg ggtgtggtgg ttacgcgcag
      481 cgtgaccgct acacttgcca gcgccctagc gcccgctcct ttcgctttct tcccttcctt
      541 tctcgccacg ttcgccggct ttccccgtca agctctaaat cgggggctcc ctttagggtt
      601 ccgatttagt gctttacggc acctcgaccc caaaaaactt gattagggtg atggttcacg
      661 tagtgggcca tcgccctgat agacggtttt tcgccctttg acgttggagt ccacgttctt
      721 taatagtgga ctcttgttcc aaactggaac aacactcaac cctatctcgg tctattcttt
      781 tgatttataa gggattttgc cgatttcggc ctattggtta aaaaatgagc tgatttaaca
      841 aaaatttaac gcgaatttta acaaaatatt aacgcttaca atttgatctg cgctcggtcg
      901 ttcggctgcg gcgagcggta tcagctcact caaagcggta atacggttat cccagaatcc
      961 ggggataacg caggaaagac aggtggcact tttcggggaa atgtgcgcgg aacccctatt
     1021 tgtttatttt tctaaataca ttcaaatatg tatccgctca tgagacaata accctgataa
     1081 atgcttcaat aatattgaaa aaggaagagt atgagtattc aacatttccg tgtcgccctt
     1141 attccctttt ttgcggcatt ttgccttcct gtttttgctc acccagaaac gctggtgaaa
     1201 gtaaaagatg ctgaagatca gttgggtgca cgagtgggtt acatcgaact ggatctcaac
     1261 agcggtaaga tccttgagag ttttcgcccc gaagaacgtt ttccaatgat gagcactttt
     1321 aaagttctgc tatgtggcgc ggtattatcc cgtgttgacg ccgggcaaga gcaactcggt
     1381 cgccgcatac actattctca gaatgacttg gttgagtact caccagtcac agaaaagcat
     1441 cttacggatg gcatgacagt aagagaatta tgcagtgctg ccataaccat gagtgataac
     1501 actgcggcca acttacttct gacaacgatc ggaggaccga aggagctaac cgcttttttg
     1561 cacaacatgg gggatcatgt aactcgcctt gatcgttggg aaccggagct gaatgaagcc
     1621 ataccaaacg acgagcgtga caccacgatg cctgcagcaa tggcaacaac gttgcgcaaa
     1681 ctattaactg gcgaactact tactctagct tcccggcaac aattaataga ctggatggag
     1741 gcggataaag ttgcaggacc acttctgcgc tcggcccttc cggctggctg gtttattgct
     1801 gataaatctg gagccggtga gcgtgggtct cgcggtatca ttgcagcact ggggccagat
     1861 ggtaagccct cccgtatcgt agttatctac acgacgggga gtcaggcaac tatggatgaa
     1921 cgaaatagac agatcgctga gataggtgcc tcactgatta agcattggta actgtcagac
     1981 caagtttact catatatact ttagattgat ttaaaacttc atttttaatt taaaaggatc
     2041 taggtgaaga tcctttttga taatctcatg accaaaatcc cttaacgtga gttttcgttc
     2101 cactgagcgt cagaccccgt agaaaagatc aaaggatctt cttgagatcc tttttttctg
     2161 cgcgtaatct gctgcttgca aacaaaaaaa ccaccgctac cagcggtggt ttgtttgccg
     2221 gatcaagagc taccaactct ttttccgaag gtaactggct tcagcagagc gcagatacca
     2281 aatactgtcc ttctagtgta gccgtagtta ggccaccact tcaagaactc tgtagcaccg
     2341 cctacatacc tcgctctgct aatcctgtta ccagtggctg ctgccagtgg cgataagtcg
     2401 tgtcttaccg ggttggactc aagacgatag ttaccggata aggcgcagcg gtcgggctga
     2461 acggggggtt cgtgcacaca gcccagcttg gagcgaacga cctacaccga agtactgaga
     2521 tacctacagc gtgagctatg agaaagcgcc acgcttcccg aagggagaaa ggcggacagg
     2581 tatccggtaa gcggcagggt cggaacagga gagcgcacga gggagcttcc agggggaaac
     2641 gcctggtatc tttatagtcc tgtcgggttt cgccacctct gacttgagcg tcgatttttg
     2701 tgatgctcgt caggggggcg gagcctatgg aaaaacgcca gcaacgcggc ctttttacgg
     2761 ttcctggcct tttgctggcc ttttgctcac atgttctttc ctgcgttatc ccctgattct
     2821 gtggataacc gtattaccgc ctttgagtga gctgataccg ctcgccgcag ccgaacgacc
     2881 gagcgcagcg agtcagtgag cgaggaagcg gaagagcgcc caatacgcaa accgcctctc
     2941 cccgcgcgtt ggccgattca ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg
     3001 ggcagtgagc gcaacgcaat taatgtgagt tagctcactc attaggcacc ccaggcttta
     3061 cactttatgc ttccggcata ttctcaataa accctttagg gaaataggcc aggttttcac
     3121 cgtaacacgc cacatcttgc gaatatatgt gtagaaactg ccggaaatcg tcgtggtatt
     3181 cactccagag cgatgaaaac gtttcagttt gctcatggaa aacggtgtaa caagggtgaa
     3241 cactatccca tatcaccagc tcaccgtctt tcattgccat acgaaattcc ggatgagcat
     3301 tcatcaggcg ggcaagaatg tgaataaagg ccggataaaa cttgtgctta tttttcttta
     3361 cggtctttaa aaaggccgta atatccagct aaacggtctg gttataggta cattgagcaa
     3421 ctgactgaaa tgcctcaaaa tgttctttac gatgccattg ggatatatca acggtggtat
     3481 atccagtgat ttttttctcc attttagctt ccttagctcc tgaaaatctc gataactcaa
     3541 aaaatacgcc cggtagtgat cttatttcat tatggtgaaa gttggaacct cttacgtgcc
     3601 gatcaacgtc tcattttcgc caaaagttgg cccagggctt cccggtatca acagggacac
     3661 caggatttat ttattctgcg aagtgatctt ccgtcacagg tatttattcg aagacgaaag
     3721 ggcatcgcgc gcggggaatt cccgggagag ctcgatatcg catgcggtac ctctagaaga
     3781 agcttggaga caaggtaaag gataaaacag cacaattcca agaaaaacac gatttagaac
     3841 ctaaaaagaa cgaatttgaa ctaactcata accgagaggt aaaaaaagaa cgaagtcgag
     3901 atcagggaat gagtttataa aataaaaaaa gcacctgaaa aggtgtcttt ttttgatggt
     3961 tttgaacttg ttctttctta tcttgataca tatagaaata acgtcatttt tattttagtt
     4021 gctgaaaggt gcgttgaagt gttggtatgt atgtgtttta aagtattgaa aacccttaaa
     4081 attggttgca cagaaaaacc ccatctgtta aagttataag tgactaaaca aataactaaa
     4141 tagatggggg tttcttttaa tattatgtgt cctaatagta gcatttattc agatgaaaaa
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart