pmCherry- N1

$216.00

  • Model: PVT1232
  • 50 Units in Stock
Ask a question


Add to Cart:

pmCherry-N1

PVT1232        2ug
 

pmCherry-N1 Information

Promoter: CMV

Replicator: pUC ori, F1 ori

Terminator: SV40 poly (A) signal

Plasmid classification: mammalian cells, fluorescent protein reporting carriers

Plasmid size: 4722bp

Prokaryotic resistance: Kan

Screening markers: Neo

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: mCherry-R:TTGGTCACCTTCAGCTTGG

 

pmCherry-N1 Desciption

pmCherry-N1 is a mammalian expression vector designed to express a protein of interestfused to the N-terminus of mCherry, a mutant fluorescent protein derived from thetetrameric Discosoma sp. red fluorescent protein, DsRed (1). The excitation and emission maxima of the native mCherry protein are 587 nm and 610 nm, respectively. Expression of fusion proteins that retain the fluorescent properties of the unmodified mCherry protein can be monitored by flow cytometry and their localization in vivo can be determined by fluorescence microscopy.

pmCherry-N1-plasmid

 

pmCherry-N1 Sequence

LOCUS       Exported                4722 bp ds-DNA    circular SYN 22-10-2015

DEFINITION  .

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 4

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4722)

  AUTHORS   admin

  TITLE     Direct Submission

  JOURNAL   Exported 2015-10-22 

FEATURES             Location/Qualifiers

     source          1..4722

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        61..364

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        365..568

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     misc_feature    591..671

                     /note="MCS"

                     /note="multiple cloning site"

     CDS             679..1389

                     /codon_start=1

                     /product="monomeric derivative of DsRed fluorescent protein

                     (Shaner et al., 2004)"

                     /note="mCherry"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG

                     TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF

                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK

                     GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA

                     EGRHSTGGMDELYK"

     polyA_signal    1510..1631

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(1638..2093)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2120..2224

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        2226..2583

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      2434..2569

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     CDS             2618..3412

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     polyA_signal    3644..3691

                     /note="HSV TK poly(A) signal"

                     /note="herpesvirus thymidine kinase polyadenylation signal"

     rep_origin      4020..4608

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg

       61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt

      121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca

      181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc

      241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta

      301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac

      361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg

      421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg

      481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt

      541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta

      601 ccggactcag atctcgagct caagcttcga attctgcagt cgacggtacc gcgggcccgg

      661 gatccaccgg tcgccaccat ggtgagcaag ggcgaggagg ataacatggc catcatcaag

      721 gagttcatgc gcttcaaggt gcacatggag ggctccgtga acggccacga gttcgagatc

      781 gagggcgagg gcgagggccg cccctacgag ggcacccaga ccgccaagct gaaggtgacc

      841 aagggtggcc ccctgccctt cgcctgggac atcctgtccc ctcagttcat gtacggctcc

      901 aaggcctacg tgaagcaccc cgccgacatc cccgactact tgaagctgtc cttccccgag

      961 ggcttcaagt gggagcgcgt gatgaacttc gaggacggcg gcgtggtgac cgtgacccag

     1021 gactcctccc tgcaggacgg cgagttcatc tacaaggtga agctgcgcgg caccaacttc

     1081 ccctccgacg gccccgtaat gcagaagaag accatgggct gggaggcctc ctccgagcgg

     1141 atgtaccccg aggacggcgc cctgaagggc gagatcaagc agaggctgaa gctgaaggac

     1201 ggcggccact acgacgctga ggtcaagacc acctacaagg ccaagaagcc cgtgcagctg

     1261 cccggcgcct acaacgtcaa catcaagttg gacatcacct cccacaacga ggactacacc

     1321 atcgtggaac agtacgaacg cgccgagggc cgccactcca ccggcggcat ggacgagctg

     1381 tacaagtagc ggccgcgact ctagatcata atcagccata ccacatttgt agaggtttta

     1441 cttgctttaa aaaacctccc acacctcccc ctgaacctga aacataaaat gaatgcaatt

     1501 gttgttgtta acttgtttat tgcagcttat aatggttaca aataaagcaa tagcatcaca

     1561 aatttcacaa ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc

     1621 aatgtatctt aaggcgtaaa ttgtaagcgt taatattttg ttaaaattcg cgttaaattt

     1681 ttgttaaatc agctcatttt ttaaccaata ggccgaaatc ggcaaaatcc cttataaatc

     1741 aaaagaatag accgagatag ggttgagtgt tgttccagtt tggaacaaga gtccactatt

     1801 aaagaacgtg gactccaacg tcaaagggcg aaaaaccgtc tatcagggcg atggcccact

     1861 acgtgaacca tcaccctaat caagtttttt ggggtcgagg tgccgtaaag cactaaatcg

     1921 gaaccctaaa gggagccccc gatttagagc ttgacgggga aagccggcga acgtggcgag

     1981 aaaggaaggg aagaaagcga aaggagcggg cgctagggcg ctggcaagtg tagcggtcac

     2041 gctgcgcgta accaccacac ccgccgcgct taatgcgccg ctacagggcg cgtcaggtgg

     2101 cacttttcgg ggaaatgtgc gcggaacccc tatttgttta tttttctaaa tacattcaaa

     2161 tatgtatccg ctcatgagac aataaccctg ataaatgctt caataatatt gaaaaaggaa

     2221 gagtcctgag gcggaaagaa ccagctgtgg aatgtgtgtc agttagggtg tggaaagtcc

     2281 ccaggctccc cagcaggcag aagtatgcaa agcatgcatc tcaattagtc agcaaccagg

     2341 tgtggaaagt ccccaggctc cccagcaggc agaagtatgc aaagcatgca tctcaattag

     2401 tcagcaacca tagtcccgcc cctaactccg cccatcccgc ccctaactcc gcccagttcc

     2461 gcccattctc cgccccatgg ctgactaatt ttttttattt atgcagaggc cgaggccgcc

     2521 tcggcctctg agctattcca gaagtagtga ggaggctttt ttggaggcct aggcttttgc

     2581 aaagatcgat caagagacag gatgaggatc gtttcgcatg attgaacaag atggattgca

     2641 cgcaggttct ccggccgctt gggtggagag gctattcggc tatgactggg cacaacagac

     2701 aatcggctgc tctgatgccg ccgtgttccg gctgtcagcg caggggcgcc cggttctttt

     2761 tgtcaagacc gacctgtccg gtgccctgaa tgaactgcaa gacgaggcag cgcggctatc

     2821 gtggctggcc acgacgggcg ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg

     2881 aagggactgg ctgctattgg gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc

     2941 tcctgccgag aaagtatcca tcatggctga tgcaatgcgg cggctgcata cgcttgatcc

     3001 ggctacctgc ccattcgacc accaagcgaa acatcgcatc gagcgagcac gtactcggat

     3061 ggaagccggt cttgtcgatc aggatgatct ggacgaagag catcaggggc tcgcgccagc

     3121 cgaactgttc gccaggctca aggcgagcat gcccgacggc gaggatctcg tcgtgaccca

     3181 tggcgatgcc tgcttgccga atatcatggt ggaaaatggc cgcttttctg gattcatcga

     3241 ctgtggccgg ctgggtgtgg cggaccgcta tcaggacata gcgttggcta cccgtgatat

     3301 tgctgaagag cttggcggcg aatgggctga ccgcttcctc gtgctttacg gtatcgccgc

     3361 tcccgattcg cagcgcatcg ccttctatcg ccttcttgac gagttcttct gagcgggact

     3421 ctggggttcg aaatgaccga ccaagcgacg cccaacctgc catcacgaga tttcgattcc

     3481 accgccgcct tctatgaaag gttgggcttc ggaatcgttt tccgggacgc cggctggatg

     3541 atcctccagc gcggggatct catgctggag ttcttcgccc accctagggg gaggctaact

     3601 gaaacacgga aggagacaat accggaagga acccgcgcta tgacggcaat aaaaagacag

     3661 aataaaacgc acggtgttgg gtcgtttgtt cataaacgcg gggttcggtc ccagggctgg

     3721 cactctgtcg ataccccacc gagaccccat tggggccaat acgcccgcgt ttcttccttt

     3781 tccccacccc accccccaag ttcgggtgaa ggcccagggc tcgcagccaa cgtcggggcg

     3841 gcaggccctg ccatagcctc aggttactca tatatacttt agattgattt aaaacttcat

     3901 ttttaattta aaaggatcta ggtgaagatc ctttttgata atctcatgac caaaatccct

     3961 taacgtgagt tttcgttcca ctgagcgtca gaccccgtag aaaagatcaa aggatcttct

     4021 tgagatcctt tttttctgcg cgtaatctgc tgcttgcaaa caaaaaaacc accgctacca

     4081 gcggtggttt gtttgccgga tcaagagcta ccaactcttt ttccgaaggt aactggcttc

     4141 agcagagcgc agataccaaa tactgtcctt ctagtgtagc cgtagttagg ccaccacttc

     4201 aagaactctg tagcaccgcc tacatacctc gctctgctaa tcctgttacc agtggctgct

     4261 gccagtggcg ataagtcgtg tcttaccggg ttggactcaa gacgatagtt accggataag

     4321 gcgcagcggt cgggctgaac ggggggttcg tgcacacagc ccagcttgga gcgaacgacc

     4381 tacaccgaac tgagatacct acagcgtgag ctatgagaaa gcgccacgct tcccgaaggg

     4441 agaaaggcgg acaggtatcc ggtaagcggc agggtcggaa caggagagcg cacgagggag

     4501 cttccagggg gaaacgcctg gtatctttat agtcctgtcg ggtttcgcca cctctgactt

     4561 gagcgtcgat ttttgtgatg ctcgtcaggg gggcggagcc tatggaaaaa cgccagcaac

     4621 gcggcctttt tacggttcct ggccttttgc tggccttttg ctcacatgtt ctttcctgcg

     4681 ttatcccctg attctgtgga taaccgtatt accgccatgc at

//


Caution:
Product is for research use only!

 

Search name

pmCherry-N1,Plasmid pmCherry-N1,pmCherry-N1 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart