pMD2.G

  • Model: PVT2321
  • 0 Units in Stock
Ask a question


 Sold Out 

pMD2.G

PVT2321      2ug

 

pMD2.G Information

Promoter: CMV

Replicon: pUC ori

Terminator: beta-globin poly (A)

Plasmid classification: virus series, lentiviral packaging carrier

Plasmid size: 5822bp

Plasmid label: VSV-G

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pMD2.G Description

PMD2. belong to the VSV-G expression plasmid, and can be used together with pSPAX2.

pMD2.G

 

pMD2.G Sequence

LOCUS       Exported                5822 bp ds-DNA     circular SYN 24-OCT-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 3

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5822)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Monday, October 24, 2016 from SnapGene Viewer 3.2.1

            http://www.snapgenemialingbio.com

FEATURES             Location/Qualifiers

     source          1..5822

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     polyA_site      1048..1442

                     /note="beta-globin poly(A)"

                     /note="human beta-globin polyadenylation signal"

     rep_origin      complement(1952..2540)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(2711..3571)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(3572..3676)

                     /gene="bla"

                     /note="AmpR promoter"

     enhancer        3867..4246

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        4247..4450

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     intron          4584..5059

                     /note="beta-globin intron"

                     /note="internally truncated intron from human beta-globin"

     CDS             5134..847

                     /codon_start=1

                     /product="vesicular stomatitis virus G glycoprotein"

                     /note="VSV-G"

                     /note="Indiana strain"

                     /translation="MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSD

                     LNWHNDLIGTALQVKMPKSHKAIQADGWMCHASKWVTTCDFRWYGPKYITHSIRSFTPS

                     VEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAVIVQVTPHHVLVDEYTGEWVDSQ

                     FINGKCSNYICPTVHNSTTWHSDYKVKGLCDSNLISMDITFFSEDGELSSLGKEGTGFR

                     SNYFAYETGGKACKMQYCKHWGVRLPSGVWFEMADKDLFAAARFPECPEGSSISAPSQT

                     SVDVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSYLAPKNPGTGPAFTIINGTLK

                     YFETRYIRVDIAAPILSRMVGMISGTTTERELWDDWAPYEDVEIGPNGVLRTSSGYKFP

                     LYMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDDESLFFGDTGLSKNPIELVEGWF

                     SSWKSSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTKKRQIYTDIEMNRLGK"

ORIGIN

        1 tggaggcaag gcctgcaaaa tgcaatactg caagcattgg ggagtcagac tcccatcagg

       61 tgtctggttc gagatggctg ataaggatct ctttgctgca gccagattcc ctgaatgccc

      121 agaagggtca agtatctctg ctccatctca gacctcagtg gatgtaagtc taattcagga

      181 cgttgagagg atcttggatt attccctctg ccaagaaacc tggagcaaaa tcagagcggg

      241 tcttccaatc tctccagtgg atctcagcta tcttgctcct aaaaacccag gaaccggtcc

      301 tgctttcacc ataatcaatg gtaccctaaa atactttgag accagataca tcagagtcga

      361 tattgctgct ccaatcctct caagaatggt cggaatgatc agtggaacta ccacagaaag

      421 ggaactgtgg gatgactggg caccatatga agacgtggaa attggaccca atggagttct

      481 gaggaccagt tcaggatata agtttccttt atacatgatt ggacatggta tgttggactc

      541 cgatcttcat cttagctcaa aggctcaggt gttcgaacat cctcacattc aagacgctgc

      601 ttcgcaactt cctgatgatg agagtttatt ttttggtgat actgggctat ccaaaaatcc

      661 aatcgagctt gtagaaggtt ggttcagtag ttggaaaagc tctattgcct cttttttctt

      721 tatcataggg ttaatcattg gactattctt ggttctccga gttggtatcc atctttgcat

      781 taaattaaag cacaccaaga aaagacagat ttatacagac atagagatga accgacttgg

      841 aaagtaactc aaatcctgca caacagattc ttcatgtttg gaccaaatca acttgtgata

      901 ccatgctcaa agaggcctca attatatttg agtttttaat ttttatgaaa aaaaaaaaaa

      961 aaaacggaat tcaccccacc agtgcaggct gcctatcaga aagtggtggc tggtgtggct

     1021 aatgccctgg cccacaagta tcactaagct cgctttcttg ctgtccaatt tctattaaag

     1081 gttcctttgt tccctaagtc caactactaa actgggggat attatgaagg gccttgagca

     1141 tctggattct gcctaataaa aaacatttat tttcattgca atgatgtatt taaattattt

     1201 ctgaatattt tactaaaaag ggaatgtggg aggtcagtgc atttaaaaca taaagaaatg

     1261 aagagctagt tcaaaccttg ggaaaataca ctatatctta aactccatga aagaaggtga

     1321 ggctgcaaac agctaatgca cattggcaac agcccctgat gcctatgcct tattcatccc

     1381 tcagaaaagg attcaagtag aggcttgatt tggaggttaa agttttgcta tgctgtattt

     1441 tacattactt attgttttag ctgtcctcat gaatgtcttt tcactaccca tttgcttatc

     1501 ctgcatctct cagccttgac tccactcagt tctcttgctt agagatacca cctttcccct

     1561 gaagtgttcc ttccatgttt tacggcgaga tggtttctcc tcgcctggcc actcagcctt

     1621 agttgtctct gttgtcttat agaggtctac ttgaagaagg aaaaacaggg ggcatggttt

     1681 gactgtcctg tgagcccttc ttccctgcct cccccactca cagtgacccg gaatccctcg

     1741 acatggcagt ctagcactag tgcggccgca gatctgcttc ctcgctcact gactcgctgc

     1801 gctcggtcgt tcggctgcgg cgagcggtat cagctcactc aaaggcggta atacggttat

     1861 ccacagaatc aggggataac gcaggaaaga acatgtgagc aaaaggccag caaaaggcca

     1921 ggaaccgtaa aaaggccgcg ttgctggcgt ttttccatag gctccgcccc cctgacgagc

     1981 atcacaaaaa tcgacgctca agtcagaggt ggcgaaaccc gacaggacta taaagatacc

     2041 aggcgtttcc ccctggaagc tccctcgtgc gctctcctgt tccgaccctg ccgcttaccg

     2101 gatacctgtc cgcctttctc ccttcgggaa gcgtggcgct ttctcatagc tcacgctgta

     2161 ggtatctcag ttcggtgtag gtcgttcgct ccaagctggg ctgtgtgcac gaaccccccg

     2221 ttcagcccga ccgctgcgcc ttatccggta actatcgtct tgagtccaac ccggtaagac

     2281 acgacttatc gccactggca gcagccactg gtaacaggat tagcagagcg aggtatgtag

     2341 gcggtgctac agagttcttg aagtggtggc ctaactacgg ctacactaga agaacagtat

     2401 ttggtatctg cgctctgctg aagccagtta ccttcggaaa aagagttggt agctcttgat

     2461 ccggcaaaca aaccaccgct ggtagcggtg gtttttttgt ttgcaagcag cagattacgc

     2521 gcagaaaaaa aggatctcaa gaagatcctt tgatcttttc tacggggtct gacgctcagt

     2581 ggaacgaaaa ctcacgttaa gggattttgg tcatgagatt atcaaaaagg atcttcacct

     2641 agatcctttt aaattaaaaa tgaagtttta aatcaatcta aagtatatat gagtaaactt

     2701 ggtctgacag ttaccaatgc ttaatcagtg aggcacctat ctcagcgatc tgtctatttc

     2761 gttcatccat agttgcctga ctccccgtcg tgtagataac tacgatacgg gagggcttac

     2821 catctggccc cagtgctgca atgataccgc gagacccacg ctcaccggct ccagatttat

     2881 cagcaataaa ccagccagcc ggaagggccg agcgcagaag tggtcctgca actttatccg

     2941 cctccatcca gtctattaat tgttgccggg aagctagagt aagtagttcg ccagttaata

     3001 gtttgcgcaa cgttgttgcc attgctacag gcatcgtggt gtcacgctcg tcgtttggta

     3061 tggcttcatt cagctccggt tcccaacgat caaggcgagt tacatgatcc cccatgttgt

     3121 gcaaaaaagc ggttagctcc ttcggtcctc cgatcgttgt cagaagtaag ttggccgcag

     3181 tgttatcact catggttatg gcagcactgc ataattctct tactgtcatg ccatccgtaa

     3241 gatgcttttc tgtgactggt gagtactcaa ccaagtcatt ctgagaatag tgtatgcggc

     3301 gaccgagttg ctcttgcccg gcgtcaatac gggataatac cgcgccacat agcagaactt

     3361 taaaagtgct catcattgga aaacgttctt cggggcgaaa actctcaagg atcttaccgc

     3421 tgttgagatc cagttcgatg taacccactc gtgcacccaa ctgatcttca gcatctttta

     3481 ctttcaccag cgtttctggg tgagcaaaaa caggaaggca aaatgccgca aaaaagggaa

     3541 taagggcgac acggaaatgt tgaatactca tactcttcct ttttcaatat tattgaagca

     3601 tttatcaggg ttattgtctc atgagcggat acatatttga atgtatttag aaaaataaac

     3661 aaataggggt tccgcgcaca tttccccgaa aagtgccacc tgacgtggat cccctgaggg

     3721 ggcccccatg ggctagagga tccggcctcg gcctctgcat aaataaaaaa aattagtcag

     3781 ccatgagctt ggcccattgc atacgttgta tccatatcat aatatgtaca tttatattgg

     3841 ctcatgtcca acattaccgc catgttgaca ttgattattg actagttatt aatagtaatc

     3901 aattacgggg tcattagttc atagcccata tatggagttc cgcgttacat aacttacggt

     3961 aaatggcccg cctggctgac cgcccaacga cccccgccca ttgacgtcaa taatgacgta

     4021 tgttcccata gtaacgccaa tagggacttt ccattgacgt caatgggtgg agtatttacg

     4081 gtaaactgcc cacttggcag tacatcaagt gtatcatatg ccaagtacgc cccctattga

     4141 cgtcaatgac ggtaaatggc ccgcctggca ttatgcccag tacatgacct tatgggactt

     4201 tcctacttgg cagtacatct acgtattagt catcgctatt accatggtga tgcggttttg

     4261 gcagtacatc aatgggcgtg gatagcggtt tgactcacgg ggatttccaa gtctccaccc

     4321 cattgacgtc aatgggagtt tgttttggca ccaaaatcaa cgggactttc caaaatgtcg

     4381 taacaactcc gccccattga cgcaaatggg cggtaggcgt gtacggtggg aggtctatat

     4441 aagcagagct cgtttagtga accgtcagat cgcctggaga cgccatccac gctgttttga

     4501 cctccataga agacaccggg accgatccag cctcccctcg aagcttacat gtggtaccga

     4561 gctcggatcc tgagaacttc agggtgagtc tatgggaccc ttgatgtttt ctttcccctt

     4621 cttttctatg gttaagttca tgtcatagga aggggagaag taacagggta cacatattga

     4681 ccaaatcagg gtaattttgc atttgtaatt ttaaaaaatg ctttcttctt ttaatatact

     4741 tttttgttta tcttatttct aatactttcc ctaatctctt tctttcaggg caataatgat

     4801 acaatgtatc atgcctcttt gcaccattct aaagaataac agtgataatt tctgggttaa

     4861 ggcaatagca atatttctgc atataaatat ttctgcatat aaattgtaac tgatgtaaga

     4921 ggtttcatat tgctaatagc agctacaatc cagctaccat tctgctttta ttttatggtt

     4981 gggataaggc tggattattc tgagtccaag ctaggccctt ttgctaatca tgttcatacc

     5041 tcttatcttc ctcccacagc tcctgggcaa cgtgctggtc tgtgtgctgg cccatcactt

     5101 tggcaaagca cgtgagatct gaattctgac actatgaagt gccttttgta cttagccttt

     5161 ttattcattg gggtgaattg caagttcacc atagtttttc cacacaacca aaaaggaaac

     5221 tggaaaaatg ttccttctaa ttaccattat tgcccgtcaa gctcagattt aaattggcat

     5281 aatgacttaa taggcacagc cttacaagtc aaaatgccca agagtcacaa ggctattcaa

     5341 gcagacggtt ggatgtgtca tgcttccaaa tgggtcacta cttgtgattt ccgctggtat

     5401 ggaccgaagt atataacaca ttccatccga tccttcactc catctgtaga acaatgcaag

     5461 gaaagcattg aacaaacgaa acaaggaact tggctgaatc caggcttccc tcctcaaagt

     5521 tgtggatatg caactgtgac ggatgccgaa gcagtgattg tccaggtgac tcctcaccat

     5581 gtgctggttg atgaatacac aggagaatgg gttgattcac agttcatcaa cggaaaatgc

     5641 agcaattaca tatgccccac tgtccataac tctacaacct ggcattctga ctataaggtc

     5701 aaagggctat gtgattctaa cctcatttcc atggacatca ccttcttctc agaggacgga

     5761 gagctatcat ccctgggaaa ggagggcaca gggttcagaa gtaactactt tgcttatgaa

     5821 ac

//

 

Caution:
Product is for research use only!

 

Search name

pMD2.G,Plasmid pMD2.G,pMD2.G vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart