pME6032 Plasmid

$216.00

  • Model: PVT5703
  • 50 Units in Stock
Ask a question


Add to Cart:

pME6032 Plasmid

PVT5703   2ug

 

pME6032 Plasmid Information

Promoter: Tac

Replicator: pVS1 ori, p15A ori

Terminator: T4

Plasmids: broad host expression plasmids

Plasmid size: 9816bp

Prokaryotic resistance: tetracycline Tetracyclin

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Host: a wide host

Culture conditions: Reference Literature

5'sequencing primers: Based on full sequence design

3'sequencing primers: Reference Literature

Note: GenBank: DQ645594.1

 

pME6032 Plasmid Description

PME6032 can be found in many hosts by using pVS1 and p15A replicas, and can express the protein well with the strong promoter of Tac.

pME6032-plasmid

 

pME6032 Plasmid Sequence

LOCUS       Exported                9816 bp ds-DNA     circular SYN 10-SEP-2016

DEFINITION  synthetic circular DNA

KEYWORDS    pME6032

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9816)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Saturday, September 10, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..9816

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             1180..1809

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /note="pVS1 StaA"

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             2238..3311

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /note="pVS1 RepA"

                     /translation="MSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW

                     QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS

                     KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP

                     GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE

                     ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR

                     LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI

                     LVMRYRNLIEGEASAGS"

     rep_origin      3377..3571

                     /note="pVS1 oriV"

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     rep_origin      4281..4826

                     /direction=RIGHT

                     /note="p15A ori"

                     /note="Plasmids containing the medium-copy-number p15A 

                     origin of replication can be propagated in E. coli cells 

                     that contain a second plasmid with the ColE1 origin."

     misc_feature    5148..5414

                     /note="T4 terminator"

     misc_feature    5416..5473

                     /note="MCS"

     misc_feature    5478..5481

                     /note="RBS"

     protein_bind    5490..5506

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     misc_feature    complement(5514..5542)

                     /note="Tac promoter"

                     /note="strong E. coli promoter; hybrid between the trp and 

                     lac UV5 promoters"

     promoter        5776..5853

                     /gene="lacI (mutant)"

                     /note="lacIq promoter"

                     /note="In the lacIq allele, a single base change in the 

                     promoter boosts expression of the lacI gene about 10-fold."

     misc_feature    5977..6792

                     /note="LacIQ"

     CDS             complement(7821..8471)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /note="TetR"

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     CDS             8577..9776

                     /codon_start=1

                     /gene="tetA"

                     /product="tetracycline efflux protein"

                     /note="TcR"

                     /note="confers resistance to tetracycline"

                     /translation="MKPNIPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY

                     GILLALYALVQFACAPVLGALSDRFGRRPILLVSLAGATVDYAIMATAPFLWVLYIGRI

                     VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF

                     FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM

                     QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM

                     LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL

                     AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR

                     "

ORIGIN

        1 tgatccaacc cctccgctgc tatagtgcag tcggcttctg acgttcagtg cagccgtctt

       61 ctgaaaacga catgtcgcac aagtcctaag ttacgcgaca ggctgccgcc ctgccctttt

      121 cctggcgttt tcttgtcgcg tgttttagtc gcataaagta gaatacttgc gactagaacc

      181 ggagacatta cgccatgaac aagagcgccg ccgctggcct gctgggctat gcccgcgtca

      241 gcaccgacga ccaggacttg accaaccaac gggccgaact gcacgcggcc ggctgcacca

      301 agctgttttc cgagaagatc accggcacca ggcgcgaccg cccggagctg gccaggatgc

      361 ttgaccacct acgccctggc gacgttgtga cagtgaccag gctagaccgc ctggcccgca

      421 gcacccgcga cctactggac attgccgagc gcatccagga ggccggcgcg ggcctgcgta

      481 gcctggcaga gccgtgggcc gacaccacca cgccggccgg ccgcatggtg ttgaccgtgt

      541 tcgccggcat tgccgagttc gagcgttccc taatcatcga ccgcacccgg agcgggcgcg

      601 aggccgccaa ggcccgaggc gtgaagtttg gcccccgccc taccctcacc ccggcacaga

      661 tcgcgcacgc ccgcgagctg atcgaccagg aaggccgcac cgtgaaagag gcggctgcac

      721 tgcttggcgt gcatcgctcg accctgtacc gcgcacttga gcgcagcgag gaagtgacgc

      781 ccaccgaggc caggcggcgc ggtgccttcc gtgaggacgc attgaccgag gccgacgccc

      841 tggcggccgc cgagaatgaa cgccaagagg aacaagcatg aaaccgcacc aggacggcca

      901 ggacgaaccg tttttcatta ccgaagagat cgaggcggag atgatcgcgg ccgggtacgt

      961 gttcgagccg cccgcgcacg tctcaaccgt gcggctgcat gaaatcctgg ccggtttgtc

     1021 tgatgccaag ctggcggcct ggccggccag cttggccgct gaagaaaccg agcgccgccg

     1081 tctaaaaagg tgatgtgtat ttgagtaaaa cagcttgcgt catgcggtcg ctgcgtatat

     1141 gatgcgatga gtaaataaac aaatacgcaa ggggaacgca tgaaggttat cgctgtactt

     1201 aaccagaaag gcgggtcagg caagacgacc atcgcaaccc atctagcccg cgccctgcaa

     1261 ctcgccgggg ccgatgttct gttagtcgat tccgatcccc agggcagtgc ccgcgattgg

     1321 gcggccgtgc gggaagatca accgctaacc gttgtcggca tcgaccgccc gacgattgac

     1381 cgcgacgtga aggccatcgg ccggcgcgac ttcgtagtga tcgacggagc gccccaggcg

     1441 gcggacttgg ctgtgtccgc gatcaaggca gccgacttcg tgctgattcc ggtgcagcca

     1501 agcccttacg acatatgggc caccgccgac ctggtggagc tggttaagca gcgcattgag

     1561 gtcacggatg gaaggctaca agcggccttt gtcgtgtcgc gggcgatcaa aggcacgcgc

     1621 atcggcggtg aggttgccga ggcgctggcc gggtacgagc tgcccattct tgagtcccgt

     1681 atcacgcagc gcgtgagcta cccaggcact gccgccgccg gcacaaccgt tcttgaatca

     1741 gaacccgagg gcgacgctgc ccgcgaggtc caggcgctgg ccgctgaaat taaatcaaaa

     1801 ctcatttgag ttaatgaggt aaagagaaaa tgagcaaaag cacaaacacg ctaagtgccg

     1861 gccgtccgag cgcacgcagc agcaaggctg caacgttggc cagcctggca gacacgccag

     1921 ccatgaagcg ggtcaacttt cagttgccgg cggaggatca caccaagctg aagatgtacg

     1981 cggtacgcca aggcaagacc attaccgagc tgctatctga atacatcgcg cagctaccag

     2041 agtaaatgag caaatgaata aatgagtaga tgaattttag cggctaaagg aggcggcatg

     2101 gaaaatcaag aacaaccagg caccgacgcc gtggaatgcc ccatgtgtgg aggaacgggc

     2161 ggttggccag gcgtaagcgg ctgggttgtc tgccggccct gcaatggcac tggaaccccc

     2221 aagcccgagg aatcggcgtg agcggtcgca aaccatccgg cccggtacaa atcggcgcgg

     2281 cgctgggtga tgacctggtg gagaagttga aggccgcgca ggccgcccag cggcaacgca

     2341 tcgaggcaga agcacgcccc ggtgaatcgt ggcaagcggc cgctgatcga atccgcaaag

     2401 aatcccggca accgccggca gccggtgcgc cgtcgattag gaagccgccc aagggcgacg

     2461 agcaaccaga ttttttcgtt ccgatgctct atgacgtggg cacccgcgat agtcgcagca

     2521 tcatggacgt ggccgttttc cgtctgtcga agcgtgaccg acgagctggc gaggtgatcc

     2581 gctacgagct tccagacggg cacgtagagg tttccgcagg gccggccggc atggccagtg

     2641 tgtgggatta cgacctggta ctgatggcgg tttcccatct aaccgaatcc atgaaccgat

     2701 accgggaagg gaagggagac aagcccggcc gcgtgttccg tccacacgtt gcggacgtac

     2761 tcaagttctg ccggcgagcc gatggcggaa agcagaaaga cgacctggta gaaacctgca

     2821 ttcggttaaa caccacgcac gttgccatgc agcgtacgaa gaaggccaag aacggccgcc

     2881 tggtgacggt atccgagggt gaagccttga ttagccgcta caagatcgta aagagcgaaa

     2941 ccgggcggcc ggagtacatc gagatcgagc tagctgattg gatgtaccgc gagatcacag

     3001 aaggcaagaa cccggacgtg ctgacggttc accccgatta ctttttgatc gatcccggca

     3061 tcggccgttt tctctaccgc ctggcacgcc gcgccgcagg caaggcagaa gccagatggt

     3121 tgttcaagac gatctacgaa cgcagtggca gcgccggaga gttcaagaag ttctgtttca

     3181 ccgtgcgcaa gctgatcggg tcaaatgacc tgccggagta cgatttgaag gaggaggcgg

     3241 ggcaggctgg cccgatccta gtcatgcgct accgcaacct gatcgagggc gaagcatccg

     3301 ccggttccta atgtacggag cagatgctag ggcaaattgc cctagcaggg gaaaaaggtc

     3361 gaaaaggtct ctttcctgtg gatagcacgt acattgggaa cccaaagccg tacattggga

     3421 accggaaccc gtacattggg aacccaaagc cgtacattgg gaaccggtca cacatgtaag

     3481 tgactgatat aaaagagaaa aaaggcgatt tttccgccta aaactcttta aaacttatta

     3541 aaactcttaa aacccgcctg gcctgtgcat aactgtctgg ccagcgcaca gccgaagagc

     3601 tgcaaaaagc gcctaccctt cggtcgctgc gctccctacg ccccgccgct tcgcgtcggc

     3661 ctatcgcggc cgctggccgc tcaaaaatgg ctggcctacg gccaggcaat ctaccagggc

     3721 gcggacaagc cgcgccgtcg ccactcgacc gccggcgctg aggtctgcct cgtgaagaag

     3781 gtgttgctga ctcataccag ggcaatggca acaacgttgc gcaaactatt aactggcgaa

     3841 ctacttactc tagcttcccg gcaacaatta atagactgga tggaggcgga taaagttgca

     3901 ggaccacttc tgcgctcggc ccttccggct ggctggttta ttgctgataa atctggagcc

     3961 ggtgagcgtg ggtctcgcgg tatcattgca gcactggggc cagatggtaa gccctcccgt

     4021 atcgtagtta tctacacgac ggggagtcag gcaactatgg atgaacgaaa tagacagatc

     4081 gctgagatag gtgcctcact gattaagcat tggtaactgt cagaccaagt ttactcatat

     4141 atactttaga ttgatttaaa acttcatttt taatttaaaa ggatctaggt gaagatcctt

     4201 tttgataatc tcatgaccaa aatcccttaa cgtgagtttt cgttccactg agcgtcagac

     4261 cccttaataa gatgatcttc ttgagatcgt tttggtctgc gcgtaatctc ttgctctgaa

     4321 aacgaaaaaa ccgccttgca gggcggtttt tcgaaggttc tctgagctac caactctttg

     4381 aaccgaggta actggcttgg aggagcgcag tcaccaaaac ttgtcctttc agtttagcct

     4441 taaccggcgc atgacttcaa gactaactcc tctaaatcaa ttaccagtgg ctgctgccag

     4501 tggtgctttt gcatgtcttt ccgggttgga ctcaagacga tagttaccgg ataaggcgca

     4561 gcggtcggac tgaacggggg gttcgtgcat acagtccagc ttggagcgaa ctgcctaccc

     4621 ggaactgagt gtcaggcgtg gaatgagaca aacgcggcca taacagcgga atgacaccgg

     4681 taaaccgaaa ggcaggaaca ggagagcgca cgagggagcc gccaggggga aacgcctggt

     4741 atctttatag tcctgtcggg tttcgccacc actgatttga gcgtcagatt tcgtgatgct

     4801 tgtcaggggg gcggagccta tggaaaaacg gctttgccgc ggccctctca cttccctgtt

     4861 aagtatcttc ctggcatctt ccaggaaatc tccgccccgt tcgtaagcca tttccgctcg

     4921 ccgcagtcga acgaccgagc gtagcgagtc agtgagcgag gaagcggaat atatcctgta

     4981 tcacatattc tgctgacgca ccggtgcagc cttttttctc ctgccacatg aagcacttca

     5041 ctgacaccct catcagtgcc aacatagtaa gccagtatac actccgctag cgctgaggtc

     5101 tgcctcgtga agaaggtgtt gctgactcat accaggctag tccgaggagc tttatgcttg

     5161 taaaccgttt tgtgaaaaaa tttttaaaat aaaaaagggg acctctaggg tccccaatta

     5221 attagtaata taatctatta aaggtcattc aaaaggtcat ccaccggatc aattcccctg

     5281 ctcgcgcagg ctgggtgcca agctctcggg taacatcaag gcccgatcct tggagccctt

     5341 gccctcccgc acgatgatcg tgccgtgatc gaaatccaga tccttgaccc gcagttgcaa

     5401 accctcactg atccgctagt ccgaggcctc gagatctatc gatgcatgcc atggtacccg

     5461 ggagctcgaa ttctgtttcc tgtgtgaaat tgttatccgc tcacaattcc acacattata

     5521 cgagccgatg attaattgtc aacagctcat ttcagaatat ttgccagaac cgttatgatg

     5581 tcggcgcaaa aaacattatc cagaacggga gtgcgccttg agcgacacga attatgcagt

     5641 gatttacgac ctgcacagcc ataccacagc ttccgatggc tgcctgacgc cagaagcatt

     5701 ggtgcaccgt gcagtcgata agcccggatc agcttgcaat tcgcgcgcga aggcgaagcg

     5761 gcatgcattt acgttgacac catcgaatgg tgcaaaacct ttcgcggtat ggcatgatag

     5821 cgcccggaag agagtcaatt cagggtggtg aatgtgaaac cagtaacgtt atacgatgtc

     5881 gcagagtatg ccggtgtctc ttatcagacc gtttcccgcg tggtgaacca ggccagccac

     5941 gtttctgcga aaacgcggga aaaagtggaa gcggcgatgg cggagctgaa ttacattccc

     6001 aaccgcgtgg cacaacaact ggcgggcaaa cagtcgttgc tgattggcgt tgccacctcc

     6061 agtctggccc tgcacgcgcc gtcgcaaatt gtcgcggcga ttaaatctcg cgccgatcaa

     6121 ctgggtgcca gcgtggtggt gtcgatggta gaacgaagcg gcgtcgaagc ctgtaaagcg

     6181 gcggtgcaca atcttctcgc gcaacgcgtc agtgggctga tcattaacta tccgctggat

     6241 gaccaggatg ccattgctgt ggaagctgcc tgcactaatg ttccggcgtt atttcttgat

     6301 gtctctgacc agacacccat caacagtatt attttctccc atgaagacgg tacgcgactg

     6361 ggcgtggagc atctggtcgc attgggtcac cagcaaatcg cgctgttagc gggcccatta

     6421 agttctgtct cggcgcgtct gcgtctggct ggctggcata aatatctcac tcgcaatcaa

     6481 attcagccga tagcggaacg ggaaggcgac tggagtgcca tgtccggttt tcaacaaacc

     6541 atgcaaatgc tgaatgaggg catcgttccc actgcgatgc tggttgccaa cgatcagatg

     6601 gcgctgggcg caatgcgcgc cattaccgag tccgggctgc gcgttggtgc ggatatctcg

     6661 gtagtgggat acgacgatac cgaagacagc tcatgttata tcccgccgtt aaccaccatc

     6721 aaacaggatt ttcgcctgct ggggcaaacc acgtggaccg cttgctgcaa ctctctcagg

     6781 gccaggcggt gaagggcaat cagctgttgc ccgtctcact ggtgaaaaga aaaaccaccc

     6841 tggcgcccaa tacgcaaacc gcctctcccc gcgcgttggc cgattcatta atgcagctgg

     6901 cacgacaggt ttcccgactg gaaagcgggc agtgagcgca acgcaattaa tgtaagttag

     6961 cgcgaattgc aagctggccg acgcgctggg ctacgtcttg ctggcgttcg gatccgatat

     7021 cgccgtggcg gcttttgcca ttctcaccgg attcagtcgt cactcatggt gatttctcac

     7081 ttgataacct tatttttgac gaggggaaat taataggttg tattgatgtt ggacgagtcg

     7141 gaatcgcaga ccgataccag gatcttgcca tcctatggaa ctgcctcggt gagttttctc

     7201 cttcattaca gaaacggctt tttcaaaaat atggtattga taatcctgat atgaataaat

     7261 tgcagtttca tttgatgctc gatgagtttt tctaatcaga attggttaat tggttgtaac

     7321 actggcagag cattacgctg acttgacggg acggcggctt tgttgaataa atcgaacttt

     7381 tgctgagttg aaggatcaga tcacgcatct tcccgacaac gcagaccgtt ccgtggcaaa

     7441 gcaaaagttc aaaatcacca actggtccac ctacaacaaa gctctcatca accgtggctc

     7501 cctcactttc tggctggatg atggggcgat tcaggcctgg tatgagtcag caacaccttc

     7561 ttcacgaggc agacctcagc gccaggcgca cgaggccggc gcgcggaccc gcgccacggc

     7621 ccacgagcgg acgccgcagc aggagcgcca gaaggccgcc agagaggccg agcgcggccg

     7681 tgaggcttgg acgctagggc agggcatgaa aaagcccgta gcgggctgct acgggcgtct

     7741 gacgcggtgg aaagggggag gggatgttgt ctacatggct ctgctgtagt gagtgggttg

     7801 cgctccggca gcggtcctga tcaatcgtca ccctttctcg gtccttcaac gttcctgaca

     7861 acgagcctcc ttttcgccaa tccatcgaca atcaccgcga gtccctgctc gaacgctgcg

     7921 tccggaccgg cttcgtcgaa ggcgtctatc gcggcccgca acagcggcga gagcggagcc

     7981 tgttcaacgg tgccgccgcg ctcgccggca tcgctgtcgc cggcctgctc ctcaagcacg

     8041 gccccaacag tgaagtagct gattgtcatc agcgcattga cggcgtcccc ggccgaaaaa

     8101 cccgcctcgc agaggaagcg aagctgcgcg tcggccgttt ccatctgcgg tgcgcccggt

     8161 cgcgtgccgg catggatgcg cgcgccatcg cggtaggcga gcagcgcctg cctgaagctg

     8221 cgggcattcc cgatcagaaa tgagcgccag tcgtcgtcgg ctctcggcac cgaatgcgta

     8281 tgattctccg ccagcatggc ttcggccagt gcgtcgagca gcgcccgctt gttcctgaag

     8341 tgccagtaaa gcgccggctg ctgaaccccc aaccgttccg ccagtttgcg tgtcgtcaga

     8401 ccgtctacgc cgacctcgtt caacaggtcc agggcggcac ggatcactgt attcggctgc

     8461 aactttgtca tgcttgacac tttatcactg ataaacataa tatgtccacc aacttatcag

     8521 tgataaagaa tccgcgcgtt caatcggacc agcggaggct ggtccggagg ccagacgtga

     8581 aacccaacat acccctgatc gtaattctga gcactgtcgc gctcgacgct gtcggcatcg

     8641 gcctgattat gccggtgctg ccgggcctcc tgcgcgatct ggttcactcg aacgacgtca

     8701 ccgcccacta tggcattctg ctggcgctgt atgcgttggt gcaatttgcc tgcgcacctg

     8761 tgctgggcgc gctgtcggat cgtttcgggc ggcggccaat cttgctcgtc tcgctggccg

     8821 gcgccactgt cgactacgcc atcatggcga cagcgccttt cctttgggtt ctctatatcg

     8881 ggcggatcgt ggccggcatc accggggcga ctggggcggt agccggcgct tatattgccg

     8941 atatcactga tggcgatgag cgcgcgcggc acttcggctt catgagcgcc tgtttcgggt

     9001 tcgggatggt cgcgggacct gtgctcggtg ggctgatggg cggtttctcc ccccacgctc

     9061 cgttcttcgc cgcggcagcc ttgaacggcc tcaatttcct gacgggctgt ttccttttgc

     9121 cggagtcgca caaaggcgaa cgccggccgt tacgccggga ggctctcaac ccgctcgctt

     9181 cgttccggtg ggcccggggc atgaccgtcg tcgccgccct gatggcggtc ttcttcatca

     9241 tgcaacttgt cggacaggtg ccggccgcgc tttgggtcat tttcggcgag gatcgctttc

     9301 actgggacgc gaccacgatc ggcatttcgc ttgccgcatt tggcattctg cattcactcg

     9361 cccaggcaat gatcaccggc cctgtagccg cccggctcgg cgaaaggcgg gcactcatgc

     9421 tcggaatgat tgccgacggc acaggctaca tcctgcttgc cttcgcgaca cggggatgga

     9481 tggcgttccc gatcatggtc ctgcttgctt cgggtggcat cggaatgccg gcgctgcaag

     9541 caatgttgtc caggcaggtg gatgaggaac gtcaggggca gctgcaaggc tcactggcgg

     9601 cgctcaccag cctgacctcg atcgtcggac ccctcctctt cacggcgatc tatgcggctt

     9661 ctataacaac gtggaacggg tgggcatgga ttgcaggcgc tgccctctac ttgctctgcc

     9721 tgccggcgct gcgtcgcggg ctttggagcg gcgcagggca acgagccgat cgctgatcgt

     9781 ggaaacgata ggccgctcta gaactagcta gaacta

//

 

Caution:
Product is for research use only!

 

Search name

pME6032,Plasmid pME6032,pME6032 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart