pMG36e Plasmid

$236.00

  • Model: PVT5201
  • 48 Units in Stock
Ask a question


Add to Cart:

pMG36e Plasmid

PVT5201    2ug
 

pMG36e Plasmid Information

Promoter: P32
Replicator: pWV01 ori
Terminator: T
Plasmid classification: Lactococcus lactis constitutively expressed plasmid
Plasmid size: 3610bp
Resistance: Erythromycin
Tag: Erythromycin
Clone strain: DH5 alpha
Culture conditions: 37 DEG C, aerobic, LB
Host: Lactococcus lactis
Induction mode: no need to induce
Primers for 5'sequencing: Based on sequence design
Primers for 3'sequencing: Based on sequence design
Expression: Bacterial
Use:Lactic Acid Bacteria Plasmids

 

pMG36e Plasmid Sequence

LOCUS       Exported                3610 bp ds-DNA     circular SYN 14-JUL-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pMG36e
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3610)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Thursday, July 14, 2016 from SnapGene Viewer 3.1.4
            
FEATURES             Location/Qualifiers
     source          1..3610
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             227..925
                     /codon_start=1
                     /note="repA"
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNSSDVIRNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     CDS             complement(1463..2197)
                     /codon_start=1
                     /note="Emr"
                     /translation="MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFT
                     LELVKRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIYGNIPY
                     NISTDIIRKIVFDSIANEIYLIVEYGFAKRLLNTKRSLALLLMAEVDISILSMVPREYF
                     HPKPKVNSSLIRLSRKKSRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGID
                     DLNNISFEQFLSLFNSYKLFNK"
     misc_feature    2474..2652
                     /note="P32"
     CDS             2653..2892
                     /codon_start=1
                     /note="ORF"
                     /translation="MAIVSAEKFVIRARPGIDPLESTCRHASLQSLKTKVAAAVEAAKT
                     VGKGDGTTGTSDKGGGQGTPALRYLELRFKVKWY"
     CDS             complement(3215..3226)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /note="Factor Xa site"
                     /translation="IEGR"
ORIGIN
        1 ggtgatttca gaatcgaaaa aaagagttat gatttctctg acaaaagagc aagataaaaa
       61 attaacagat atggcgaaac aaaaaggttt ttcaaaatct gcggttgcgg cgttagctat
      121 agaagaatat gcaagaaagg aatcagaaca aaaaaaataa gcgaaagctc gcgtttttag
      181 aaggatacga gttttcgcta cttgtttttg ataaggtaat tatatcatgg ctattaaaaa
      241 tactaaagct agaaattttg gatttttatt atatcctgac tcaattccta atgattggaa
      301 agaaaaatta gagagtttgg gcgtatctat ggctgtcagt cctttacacg atatggacga
      361 aaaaaaagat aaagatacat ggaatagtag tgatgttata cgaaatggaa agcactataa
      421 aaaaccacac tatcacgtta tatatattgc acgaaatcct gtaacaatag aaagcgttag
      481 gaacaagatt aagcgaaaat tggggaatag ttcagttgct catgttgaga tacttgatta
      541 tatcaaaggt tcatatgaat atttgactca tgaatcaaag gacgctattg ctaagaataa
      601 acatatatac gacaaaaaag atattttgaa cattaatgat tttgatattg accgctatat
      661 aacacttgat gaaagccaaa aaagagaatt gaagaattta cttttagata tagtggatga
      721 ctataatttg gtaaatacaa aagatttaat ggcttttatt cgccttaggg gagcggagtt
      781 tggaatttta aatacgaatg atgtaaaaga tattgtttca acaaactcta gcgcctttag
      841 attatggttt gagggcaatt atcagtgtgg atatagagca agttatgcaa aggttcttga
      901 tgctgaaacg ggggaaataa aatgacaaac aaagaaaaag agttatttgc tgaaaatgag
      961 gaattaaaaa aagaaattaa ggacttaaaa gagcgtattg aaagatacag agaaatggaa
     1021 gttgaattaa gtacaacaat agatttattg agaggaggga ttattgaata aataaaagcc
     1081 ccctgacgaa agtcgaaggg ggtttttatt ttggtttgat gttgcgatta atagcaatac
     1141 aattgcaata aacaaaatga tcgacctcgg gacccctatc tagcgaactt ttagaaaaga
     1201 tataaaacat cagagtatgg acagttgcgg atgtacttca gaaaagatta gatgtctaaa
     1261 aagctagctt tttagacatc taaatctagg tactaaaaca attcatccag taaaatataa
     1321 tattttattt tctcccaatc aggcttgatc cccagtaagt caaaaaatag ctcgacatac
     1381 tgttcttccc cgatcgaccc gattcacaaa aaataggcac acgaaaaaca agttaaggga
     1441 tgcagtttat gcatccctta acttacttat taaataattt atagctattg aaaagagata
     1501 agaattgttc aaagctaata ttgtttaaat cgtcaattcc tgcatgtttt aaggaattgt
     1561 taaattgatt ttttgtaaat attttcttgt attctttgtt aacccatttc ataacgaaat
     1621 aattatactt ttgtttatct ttgtgtgata ttcttgattt ttttctactt aatctgataa
     1681 gtgagctatt cactttaggt ttaggatgaa aatattctct tggaaccata cttaatatag
     1741 aaatatcaac ttctgccatt aaaagtaatg ccaatgagcg ttttgtattt aataatcttt
     1801 tagcaaaccc gtattccacg attaaataaa tctcattagc tatactatca aaaacaattt
     1861 tgcgtattat atccgtactt atgttataag gtatattacc atatatttta taggattggt
     1921 ttttaggaaa tttaaactgc aatatatcct tgtttaaaac ttggaaatta tcgtgatcaa
     1981 caagtttatt ttctgtagtt ttgcataatt tatggtctat ttcaatggca gttacgaaat
     2041 tacacctctt tactaattca agggtaaaat ggccttttcc tgagccgatt tcaaagatat
     2101 tatcatgttc atttaatctt atatttgtca ttattttatc tatattatgt tttgaagtaa
     2161 taaagttttg actgtgtttt atatttttct cgttcattat aaccctcttt aatttggtta
     2221 tatgaatttt gcttattaac gattcattat aaccacttat tttttgtttg gttgataatg
     2281 aactgtgctg attacaaaaa tactaaaaat gcccatattt tttcctcctt ataaaattag
     2341 tataattata gcacggtcga tcttctatat aaaagatata ttatcttatc agtattgtca
     2401 atatattcaa ggcaatctgc ctcctcatcc tcttcatcct cttcgtcttg gtagcttttt
     2461 aaatatgggt cgatcgaatt cggtcctcgg gatatgataa gattaatagt tttagctatt
     2521 aatctttttt tatttttatt taagaatggc ttaataaagc ggttactttg gatttttgtg
     2581 agcttggact agaaaaaaac ttcacaaaat gctatactag gtaggtaaaa aaatattcgg
     2641 aggaattttg aaatggcaat cgtttcagca gaaaaattcg taattcgagc tcgcccgggg
     2701 atcgatcctc tagagtcgac ctgcaggcat gcaagcttgc aaagtctgaa aacgaaggtg
     2761 gcagctgccg ttgaagcggc caagacagtt ggtaaaggcg acggtacaac cggtactagc
     2821 gacaaaggcg gcggtcaagg taccccggcg ctacgatatt tggagttgag gttcaaagtc
     2881 aaatggtact gatgaccggt aaaatttaat attttgaacc ttgcttaggc agctgacttc
     2941 acattgttga gatcagctgc cttttgctta tagttcattg agtagaaacg gttctgttgc
     3001 gaagtttgaa aatcaaacgc aagctcgatt ttttattaaa acgtctcaaa atcgtttctg
     3061 agacgtttta gcgtttattt cgtttagtta tcggcataat cgttaaaaca ggcgttatcg
     3121 tagcgtaaaa gcccttgagc gtagcgtggc tttgcagcga agatgttgtc tgttagatta
     3181 tgaaagccga tgactgaatg aaataataag cgcagcgccc ttctatttcg gttggaggag
     3241 gctcaaggga gtatgaggga atgaaattcc ctcatgggtt tgattttaaa aattgcttgc
     3301 aattttgccg agcggtagcg ctggaaaatt tttgaaaaaa atttggaatt tggaaaaaaa
     3361 tggggggaaa ggaagcgaat tttgcttccg tactacgacc ccccattaag tgccgagtgc
     3421 caatttttgt gccaaaaacg ctctatccca actggctcaa gggtttaagg ggtttttcaa
     3481 tcgccaacga atcgccaacg ttttcgccaa cgttttttat aaatctatat ttaagtagct
     3541 ttattgttgt ttttatgatt acaaagtgat acactaactt tataaaatta tttgattgga
     3601 gttttttaat
//
 
Caution:
Product is for research use only!
 

Search name

pMG36e,Plasmid pMG36e,pMG36e vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart