pMK4

$260.00

  • Model: PVT12369
  • 20 Units in Stock
Ask a question


Add to Cart:

pMK4

PVT12369    2ug
 

 

pMK4 Search name

pMK4,pMK4 vector,pMK4 plasmid,pMK4 map

 

 

pMK4 Information

Bacterial Resistance(s):   Amp

Screening: Chl 
Growth Strain(s): DH5 alpha
Growth Condition: LB/37 Centigrade

pMK4-vector

pMK4 Sequence

LOCUS       Exported                5585 bp ds-DNA     circular SYN 21-SEP-2018

DEFINITION  synthetic circular DNA

KEYWORDS    pMK4

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5585)

  AUTHORS   Triple Threat

FEATURES             Location/Qualifiers

     source          1..5585

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             216..518

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /note="lacZ-alpha"

                     /translation="MTMITPSLAAGRRIPGNSLAVVLQRRDWENPGVTQLNRLAAHPPF

                     ASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRIWCTLSTICSDAA"

     misc_feature    241..268

                     /note="MCS"

     promoter        759..863

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             864..1724

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     CDS             3965..4615

                     /codon_start=1

                     /note="Chl"

                     /translation="MNFNKIDLDNWKRKEIFNHYLNQQTTFSITTEIDISVLYRNIKQE

                     GYKFYPAFIFLVTRVINSNTAFRTGYNSDGELGYWDKLEPLYTIFDGVSKTFSGIWTPV

                     KNDFKEFYDLYLSDVEKYNGSGKLFPKTPIPENAFSLSIIPWTSFTGFNLNINNNSNYL

                     LPIITAGKFINKGNSIYLPLSLQVHHSVCDGYHAGLFMNSIQELSDRPNDWLL"

     rep_origin      4815..5403

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 gcgcccaata cgcaaaccgc ctctccccgc gcgttggccg attcattaat gcagctggca

       61 cgacaggttt cccgactgga aagcgggcag tgagcgcaac gcaattaatg tgagttagct

      121 cactcattag gcaccccagg ctttacactt tatgcttccg gctcgtatgt tgtgtggaat

      181 tgtgagcgga taacaatttc acacaggaaa cagctatgac catgattacg ccaagcttgg

      241 ctgcaggtcg acggatcccc gggaattcac tggccgtcgt tttacaacgt cgtgactggg

      301 aaaaccctgg cgttacccaa cttaatcgcc ttgcagcaca tccccctttc gccagctggc

      361 gtaatagcga agaggcccgc accgatcgcc cttcccaaca gttgcgcagc ctgaatggcg

      421 aatggcgcct gatgcggtat tttctcctta cgcatctgtg cggtatttca caccgcatat

      481 ggtgcactct cagtacaatc tgctctgatg ccgcatagtt aagccagccc cgacacccgc

      541 caacacccgc tgacgcgccc tgacgggctt gtctgctccc ggcatccgct tacagacaag

      601 ctgtgaccgt ctccgggagc tgcatgtgtc agaggttttc accgtcatca ccgaaacgcg

      661 cgagacgaaa gggcctcgtg atacgcctat ttttataggt taatgtcatg ataataatgg

      721 tttcttagac gtcaggtggc acttttcggg gaaatgtgcg cggaacccct atttgtttat

      781 ttttctaaat acattcaaat atgtatccgc tcatgagaca ataaccctga taaatgcttc

      841 aataatattg aaaaaggaag agtatgagta ttcaacattt ccgtgtcgcc cttattccct

      901 tttttgcggc attttgcctt cctgtttttg ctcacccaga aacgctggtg aaagtaaaag

      961 atgctgaaga tcagttgggt gcacgagtgg gttacatcga actggatctc aacagcggta

     1021 agatccttga gagttttcgc cccgaagaac gttttccaat gatgagcact tttaaagttc

     1081 tgctatgtgg cgcggtatta tcccgtattg acgccgggca agagcaactc ggtcgccgca

     1141 tacactattc tcagaatgac ttggttgagt actcaccagt cacagaaaag catcttacgg

     1201 atggcatgac agtaagagaa ttatgcagtg ctgccataac catgagtgat aacactgcgg

     1261 ccaacttact tctgacaacg atcggaggac cgaaggagct aaccgctttt ttgcacaaca

     1321 tgggggatca tgtaactcgc cttgatcgtt gggaaccgga gctgaatgaa gccataccaa

     1381 acgacgagcg tgacaccacg atgcctgtag caatggcaac aacgttgcgc aaactattaa

     1441 ctggcgaact acttactcta gcttcccggc aacaattaat agactggatg gaggcggata

     1501 aagttgcagg accacttctg cgctcggccc ttccggctgg ctggtttatt gctgataaat

     1561 ctggagccgg tgagcgtggg tctcgcggta tcattgcagc actggggcca gatggtaagc

     1621 cctcccgtat cgtagttatc tacacgacgg ggagtcaggc aactatggat gaacgaaata

     1681 gacagatcgc tgagataggt gcctcactga ttaagcattg gtaactgtca gaccaagttt

     1741 actcatatat actttagatt gatttaaaac ttcattttta atttaaaagg atctaggtga

     1801 agatccatat ccttcttttt ctgaaccgac ttctcctttt tcgcttcttt attccaattg

     1861 ctttattgac gttgagcctc ggaaccctta acaatcccaa aacttgtcga atggtcggct

     1921 taatagctca cgctatgccg acattcgtct gcaagtttag ttaagggttc ttctcaacgc

     1981 acaataaatt ttctcggcat aaatgcgtgg tctaattttt atttttaata accttgatag

     2041 caaaaaatgc cattccaata caaaaccaca tacctataat cgataaccac ataacagtca

     2101 taaaaccact cctttttaac aaactttatc acaagaaata tttaaatttt aaatgccttt

     2161 attttgaatt ttaaggggca ttttaaagat ttaggggtaa atcatatagt tttatgccta

     2221 aaaacctaca gaagctttta aaaagcaaat atgagccaaa taaatatatt ctaattctac

     2281 aaacaaaaat ttgagcaaat tcagtgtcga ttttttaaga cactgcccag ttacatgcaa

     2341 attaaaattt tcatgatttt ttatagttcc taacagggtt aaaatttgta taacgaaagt

     2401 ataatgttta tataacgtta gtataataaa gcattttaac attatacttt tgataatcgt

     2461 ttatcgtcgt catcacaata acttttaaaa tactcgtgca taattcaaca gctgacctcc

     2521 caataactac atggtgttat cgggaggtca gctgttagca cttatatttt gttattgttc

     2581 ttcctcgatt tcgtctatca ttttgtgatt aatttctctt ttttcttgtt ctgttaagtc

     2641 ataaagttca ctagctaaat actctttttg tttccaaata taaaaaattt gatagatata

     2701 ttcggttgga tcaatttctt ttaagtaatc taaatcccca ttttttaatt tctttttagc

     2761 ctctttaaat aatcctgaat aaactaatac ctgtttacct ttaagtgatt tataaaatgc

     2821 atcaaagact ttttgattta ttaaataatc actatcttta ccagaatact tagccatttc

     2881 atataattct ttattattat tttgtcttat tttttgaact tgaacttgtg ttatttctga

     2941 aatgcccgtt acatcacgcc ataaatctaa ccattcttgt tggctaatat aatatctttt

     3001 atctgtgaaa tacgatttat ttactgcaat taacacatga aaatgaggat tataatcatc

     3061 tcttttttta ttatatgtaa tctctaactt acgaacatat ccctttataa cactacctac

     3121 tttttttctc tttataagtt ttctaaaaga attattataa cgttttattt cattttctaa

     3181 ttcatcactc attacattag gtgtagtcaa agttaaaaag ataaactcct ttttctcttg

     3241 ctgcttaata tattgcatca tcaaagataa acccaatgca tcttttctag cttttctcca

     3301 agcacagaca ggacaaaatc gatttttaca agaattagct ttatataatt tctgtttttc

     3361 taaagtttta tcagctacaa aagacagaaa tgtattgcaa tcttcaacta aatccatttg

     3421 attctctcca atatgacgtt taataaattt ctgaaatact tgatttcttt gttttttctc

     3481 agtatacttt tccatgttat aacacataaa aacaacttag ttttcacaaa ctatgacaat

     3541 aaaaaaagtt gctttttccc ctttctatgt atgtttttta ctagtcattt aaaacgatac

     3601 attaataggt acgaaaaagc aacttttttt gcgcttaaaa ccagtcatac caataactta

     3661 agggtaacta gcctcgccgg caatagttac ccttattatc aagataagaa agaaaaggat

     3721 ttttcgctac gctcaaatcc tttaaaaaaa cacaaaagac cacatttttt aatgtggtct

     3781 tttattcttc aactaaagca cccattagtt caacaaacga aaattggata aagtgggata

     3841 tttttaaaat atatatttat gttacagtaa tattgacttt taaaaaagga ttgattctaa

     3901 tgaagaaagc agacaagtaa gcctcctaaa ttcactttag ataaaaattt aggaggcata

     3961 tcaaatgaac tttaataaaa ttgatttaga caattggaag agaaaagaga tatttaatca

     4021 ttatttgaac caacaaacga cttttagtat aaccacagaa attgatatta gtgttttata

     4081 ccgaaacata aaacaagaag gatataaatt ttaccctgca tttattttct tagtgacaag

     4141 ggtgataaac tcaaatacag cttttagaac tggttacaat agcgacggag agttaggtta

     4201 ttgggataag ttagagccac tttatacaat ttttgatggt gtatctaaaa cattctctgg

     4261 tatttggact cctgtaaaga atgacttcaa agagttttat gatttatacc tttctgatgt

     4321 agagaaatat aatggttcgg ggaaattgtt tcccaaaaca cctatacctg aaaatgcttt

     4381 ttctctttct attattccat ggacttcatt tactgggttt aacttaaata tcaataataa

     4441 tagtaattac cttctaccca ttattacagc aggaaaattc attaataaag gtaattcaat

     4501 atatttaccg ctatctttac aggtacatca ttctgtttgt gatggttatc atgcaggatt

     4561 gtttatgaac tctattcagg aattgtcaga taggcctaat gactggcttt tataatatga

     4621 gataatgccg actgtacttt ttacagtcgg ttttctaatg tcactaacct gccccgttag

     4681 ttgaagaagg tttttatatt acagctccag atctaggtga agatcctttt tgataatctc

     4741 atgaccaaaa tcccttaacg tgagttttcg ttccactgag cgtcagaccc cgtagaaaag

     4801 atcaaaggat cttcttgaga tccttttttt ctgcgcgtaa tctgctgctt gcaaacaaaa

     4861 aaaccaccgc taccagcggt ggtttgtttg ccggatcaag agctaccaac tctttttccg

     4921 aaggtaactg gcttcagcag agcgcagata ccaaatactg ttcttctagt gtagccgtag

     4981 ttaggccacc acttcaagaa ctctgtagca ccgcctacat acctcgctct gctaatcctg

     5041 ttaccagtgg ctgctgccag tggcgataag tcgtgtctta ccgggttgga ctcaagacga

     5101 tagttaccgg ataaggcgca gcggtcgggc tgaacggggg gttcgtgcac acagcccagc

     5161 ttggagcgaa cgacctacac cgaactgaga tacctacagc gtgagctatg agaaagcgcc

     5221 acgcttcccg aagggagaaa ggcggacagg tatccggtaa gcggcagggt cggaacagga

     5281 gagcgcacga gggagcttcc agggggaaac gcctggtatc tttatagtcc tgtcgggttt

     5341 cgccacctct gacttgagcg tcgatttttg tgatgctcgt caggggggcg gagcctatgg

     5401 aaaaacgcca gcaacgcggc ctttttacgg ttcctggcct tttgctggcc ttttgctcac

     5461 atgttctttc ctgcgttatc ccctgattct gtggataacc gtattaccgc ctttgagtga

     5521 gctgataccg ctcgccgcag ccgaacgacc gagcgcagcg agtcagtgag cgaggaagcg

     5581 gaaga

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart