pML104

$160.00

  • Model: PVT11273
  • 50 Units in Stock
Ask a question


Add to Cart:

pML104

Catalog No. PVT11273
Packing 2ug

 

pML104 Information

Prokaryotic resistance: ampicillin Amp

Selection marker: URA3

Clone strain: Escherichia coli Stbl3

Culture conditions: 37degrees centigrade

Function yeast Editing plasmids

 

pML104 Description

PML104 is a gene knockout plasmid expressing CAS9 and gRNA in yeast cells.

 

pML104 Cloning site

pML104-vector

 

 

pML104 Sequence

LOCUS       Exported               11240 bp ds-DNA     circular SYN 03-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..11240

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             1..4113

                     /codon_start=1

                     /product="N-terminal portion of Streptococcus pyogenes Cas9

                     (Zetsche et al., 2015)"

                     /label=Cas9

                     /translation="MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKK

                     NLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEES

                     FLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIK

                     FRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRL

                     ENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ

                     IGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVR

                     QQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLL

                     RKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARG

                     NSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEY

                     FTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFD

                     SVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEEKEDILEDIVLTLTLFEDREMIEER

                     LKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFM

                     QLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR

                     HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY

                     LYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVP

                     SEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKH

                     VAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYL

                     NAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKT

                     EITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSK

                     ESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGI

                     TIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE

                     LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILAD

                     ANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL

                     DATLIHQSITGLYETRIDLSQLGGDEGA"

     CDS             4114..4134

                     /codon_start=1

                     /product="nuclear localization signal of SV40 (simian virus

                     40) large T antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     terminator      4162..4349

                     /gene="S. cerevisiae ADH1"

                     /label=ADH1 terminator

                     /note="transcription terminator for the S. cerevisiae 

                     alcohol dehydrogenase 1 (ADH1) gene"

     terminator      4467..4486

                     /label=SUP4 terminator

                     /note="transcription terminator for the S. cerevisiae SUP4 

                     tRNA gene"

     promoter        complement(4568..4836)

                     /label=SNR52 promoter

                     /note="promoter for the S. cerevisiae small nucleolar RNA 

                     gene SNR52"

     rep_origin      complement(5308..5896)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(6067..6927)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     promoter        complement(6928..7032)

                     /gene="bla"

                     /label=AmpR promoter

     rep_origin      7059..8401

                     /label=2u ori

                     /note="yeast 2u plasmid origin of replication"

     promoter        8663..8878

                     /gene="S. cerevisiae URA3"

                     /label=URA3 promoter

     CDS             8879..9682

                     /codon_start=1

                     /gene="S. cerevisiae URA3"

                     /product="orotidine-5'-phosphate decarboxylase, required 

                     for uracil biosynthesis"

                     /label=URA3

                     /note="yeast auxotrophic marker, counterselectable with 

                     5-fluoroorotic acid (5-FOA)"

                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL

                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ

                     YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE

                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD

                     VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"

     rep_origin      complement(9813..10268)

                     /direction=LEFT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        10540..11206

                     /gene="S. cerevisiae TDH3"

                     /label=GAP promoter

                     /note="promoter for glyceraldehyde-3-phosphate 

                     dehydrogenase"

ORIGIN

        1 atggacaaga agtattctat cggactggac atcgggacta atagcgtcgg gtgggccgtc

       61 atcactgacg agtacaaggt gccctctaag aagttcaagg tgctcgggaa caccgaccgg

      121 cattccatca agaaaaatct gatcggagct ctcctctttg attcagggga gaccgctgaa

      181 gcaacccgcc tcaagcggac tgctagacgg cggtacacca ggaggaagaa ccggatttgt

      241 taccttcaag agatattctc caacgaaatg gcaaaggtcg acgacagctt cttccatagg

      301 ctggaagaat cattcctcgt ggaagaggat aagaagcatg aacggcatcc catcttcggt

      361 aatatcgtcg acgaggtggc ctatcacgag aaatacccaa ccatctacca tcttcgcaaa

      421 aagctggtgg actcaaccga caaggcagac ctccggctta tctacctggc cctggcccac

      481 atgattaagt tcagaggcca cttcctgatc gagggcgacc tcaatcctga caatagcgat

      541 gtggataaac tgttcatcca gctggtgcag acttacaacc agctctttga agagaacccc

      601 atcaatgcaa gcggagtcga tgccaaggcc attctgtcag cccggctgtc aaagagccgc

      661 agacttgaga atcttatcgc tcagctgccg ggtgaaaaga aaaatggact gttcgggaac

      721 ctgattgctc tttcacttgg gctgactccc aatttcaagt ctaatttcga cctggcagag

      781 gatgccaagc tgcaactgtc caaggacacc tatgatgacg atctcgacaa cctcctggcc

      841 cagatcggtg accaatacgc cgaccttttc cttgctgcta agaatctttc tgacgccatc

      901 ctgctgtctg acattctccg cgtgaacact gaaatcacca aggcccctct ttcagcttca

      961 atgattaagc ggtatgatga gcaccaccag gacctgaccc tgcttaaggc actcgtccgg

     1021 cagcagcttc cggagaagta caaggaaatc ttctttgacc agtcaaagaa tggatacgcc

     1081 ggctacatcg acggaggtgc ctcccaagag gaattttata agtttatcaa acctatcctt

     1141 gagaagatgg acggcaccga agagctcctc gtgaaactga atcgggagga tctgctgcgg

     1201 aagcagcgca ctttcgacaa tgggagcatt ccccaccaga tccatcttgg ggagcttcac

     1261 gccatccttc ggcgccaaga ggacttctac ccctttctta aggacaacag ggagaagatt

     1321 gagaaaattc tcactttccg catcccctac tacgtgggac ccctcgccag aggaaatagc

     1381 cggtttgctt ggatgaccag aaagtcagaa gaaactatca ctccctggaa cttcgaagag

     1441 gtggtggaca agggagccag cgctcagtca ttcatcgaac ggatgactaa cttcgataag

     1501 aacctcccca atgagaaggt cctgccgaaa cattccctgc tctacgagta ctttaccgtg

     1561 tacaacgagc tgaccaaggt gaaatatgtc accgaaggga tgaggaagcc cgcattcctg

     1621 tcaggcgaac aaaagaaggc aattgtggac cttctgttca agaccaatag aaaggtgacc

     1681 gtgaagcagc tgaaggagga ctatttcaag aaaattgaat gcttcgactc tgtggagatt

     1741 agcggggtcg aagatcggtt caacgcaagc ctgggtacct accatgatct gcttaagatc

     1801 atcaaggaca aggattttct ggacaatgag gagaaagagg acatccttga ggacattgtc

     1861 ctgactctca ctctgttcga ggaccgggaa atgatcgagg agaggcttaa gacctacgcc

     1921 catctgttcg acgataaagt gatgaagcaa cttaaacgga gaagatatac cggatgggga

     1981 cgccttagcc gcaaactcat caacggaatc cgggacaaac agagcggaaa gaccattctt

     2041 gatttcctta agagcgacgg attcgctaat cgcaacttca tgcaacttat ccatgatgat

     2101 tccctgacct ttaaggagga catccagaag gcccaagtgt ctggacaagg tgactcactg

     2161 cacgagcata tcgcaaatct ggctggttca cccgctatta agaagggtat tctccagacc

     2221 gtgaaagtcg tggacgagct ggtcaaggtg atgggtcgcc ataaaccaga gaacattgtc

     2281 atcgagatgg ccagggaaaa ccagactacc cagaagggac agaagaacag cagggagcgg

     2341 atgaaaagaa ttgaggaagg gattaaggag ctcgggtcac agatccttaa agagcacccg

     2401 gtggaaaaca cccagcttca gaatgagaag ctctatctgt actaccttca aaatggacgc

     2461 gatatgtatg tggaccaaga gcttgatatc aacaggctct cagactacga cgtggaccac

     2521 atcgtccctc agagcttcct caaagacgac tcaattgaca ataaggtgct gactcgctca

     2581 gacaagaacc ggggaaagtc agataacgtg ccctcagagg aagtcgtgaa aaagatgaag

     2641 aactattggc gccagcttct gaacgcaaag ctaatcactc agcggaagtt cgacaatctc

     2701 actaaggctg agaggggcgg actgagcgaa ctggacaaag caggattcat taaacggcaa

     2761 cttgtggaga ctcggcagat tactaaacat gtagcccaaa tccttgactc acgcatgaat

     2821 accaagtacg acgaaaacga caaacttatc cgcgaggtga aggtgattac cctgaagtcc

     2881 aagctggtca gcgatttcag aaaggacttt caattctaca aagtgcggga gatcaataac

     2941 tatcatcatg ctcatgacgc atatctgaat gccgtggtgg gaaccgccct aatcaagaag

     3001 tacccaaagc tggaaagcga gttcgtgtac ggagactaca aggtctacga cgtgcgcaag

     3061 atgattgcca aatctgagca ggagatcgga aaggccaccg caaagtactt cttctacagc

     3121 aacatcatga atttcttcaa gaccgaaatc acccttgcaa acggtgagat ccggaagagg

     3181 ccgctcatcg agactaatgg ggagactggc gaaatcgtgt gggacaaggg cagagatttc

     3241 gctaccgtgc gcaaagtgct ttctatgcct caagtgaaca tcgtgaagaa aaccgaggtg

     3301 caaaccggag gcttttctaa ggaatcaatc ctccccaagc gcaactccga caagctcatt

     3361 gcaaggaaga aggattggga ccctaagaag tacggcggat tcgattcacc aactgtggct

     3421 tattctgtcc tggtcgtggc taaggtggaa aaaggaaagt ctaagaagct caagagcgtg

     3481 aaggaactgc tgggtatcac cattatggag cgcagctcct tcgagaagaa cccaattgac

     3541 tttctcgaag ccaaaggtta caaggaagtc aagaaggacc ttatcatcaa gctcccaaag

     3601 tatagcctgt tcgaactgga gaatgggcgg aagcggatgc tcgcctccgc tggcgaactt

     3661 cagaagggta atgagctggc tctcccctcc aagtacgtga atttcctcta ccttgcaagc

     3721 cattacgaga agctgaaggg gagccccgag gacaacgagc aaaagcaact gtttgtggag

     3781 cagcataagc attatctgga cgagatcatt gagcagattt ccgagttttc taaacgcgtc

     3841 attctcgctg atgccaacct cgataaagtc cttagcgcat acaataagca cagagacaaa

     3901 ccaattcggg agcaggctga gaatatcatc cacctgttca ccctcaccaa tcttggtgcc

     3961 cctgccgcat tcaagtactt cgacaccacc atcgaccgga aacgctatac ctccaccaaa

     4021 gaagtgctgg acgccaccct catccaccag agcatcaccg gactttacga aactcggatt

     4081 gacctctcac agctcggagg ggatgaggga gctcccaaga aaaagcgcaa ggtaggtagt

     4141 tccggatcct agactctcga ggcgaatttc ttatgattta tgatttttat tattaaataa

     4201 gttataaaaa aaataagtgt atacaaattt taaagtgact cttaggtttt aaaacgaaaa

     4261 ttcttattct tgagtaactc tttcctgtag gtcaggttgc tttctcaggt atagcatgag

     4321 gtcgctctta ttgaccacac ctctaccggc atgccgagca aatgcctgca aatcgctccc

     4381 catttctcta gagcggccgt ggtatcgttt agattggcaa ttacagtgtc ttagctcaca

     4441 tgcttataac taattacatg actcgaagac ataaaaaaca aaaaaagcac caccgactcg

     4501 gtgccacttt ttcaagttga taacggacta gccttatttt aacttgctat ttaaatgcat

     4561 cgattctgat catttatctt tcactgcgga gaagtttcga acgccgaaac atgcgcacca

     4621 actttcactt ctacagcgtt tgaccaaaat cttttgaaca gaacattgta gggtgtgaaa

     4681 aaatgcgcac ctttaccgct agcccaagag ggcactacaa aatctagagt tgtacttcaa

     4741 acgtacatgt aatcaccttg tatatactcg aaagaaaaca tcaagtttct gtataaatat

     4801 gagtgaaagc ataatcatac attatctttt caaagattgt ccgcggtgga gctccagctt

     4861 ttgttccctt tagtgagggt taattgcgcg cttggcgtaa tcatggtcat agctgtttcc

     4921 tgtgtgaaat tgttatccgc tcacaattcc acacaacata cgagccggaa gcataaagtg

     4981 taaagcctgg ggtgcctaat gagtgagcta actcacatta attgcgttgc gctcactgcc

     5041 cgctttccag tcgggaaacc tgtcgtgcca gctgcattaa tgaatcggcc aacgcgcggg

     5101 gagaggcggt ttgcgtattg ggcgctcttc cgcttcctcg ctcactgact cgctgcgctc

     5161 ggtcgttcgg ctgcggcgag cggtatcagc tcactcaaag gcggtaatac ggttatccac

     5221 agaatcaggg gataacgcag gaaagaacat gtgagcaaaa ggccagcaaa aggccaggaa

     5281 ccgtaaaaag gccgcgttgc tggcgttttt ccataggctc cgcccccctg acgagcatca

     5341 caaaaatcga cgctcaagtc agaggtggcg aaacccgaca ggactataaa gataccaggc

     5401 gtttccccct ggaagctccc tcgtgcgctc tcctgttccg accctgccgc ttaccggata

     5461 cctgtccgcc tttctccctt cgggaagcgt ggcgctttct catagctcac gctgtaggta

     5521 tctcagttcg gtgtaggtcg ttcgctccaa gctgggctgt gtgcacgaac cccccgttca

     5581 gcccgaccgc tgcgccttat ccggtaacta tcgtcttgag tccaacccgg taagacacga

     5641 cttatcgcca ctggcagcag ccactggtaa caggattagc agagcgaggt atgtaggcgg

     5701 tgctacagag ttcttgaagt ggtggcctaa ctacggctac actagaagaa cagtatttgg

     5761 tatctgcgct ctgctgaagc cagttacctt cggaaaaaga gttggtagct cttgatccgg

     5821 caaacaaacc accgctggta gcggtggttt ttttgtttgc aagcagcaga ttacgcgcag

     5881 aaaaaaagga tctcaagaag atcctttgat cttttctacg gggtctgacg ctcagtggaa

     5941 cgaaaactca cgttaaggga ttttggtcat gagattatca aaaaggatct tcacctagat

     6001 ccttttaaat taaaaatgaa gttttaaatc aatctaaagt atatatgagt aaacttggtc

     6061 tgacagttac caatgcttaa tcagtgaggc acctatctca gcgatctgtc tatttcgttc

     6121 atccatagtt gcctgactcc ccgtcgtgta gataactacg atacgggagg gcttaccatc

     6181 tggccccagt gctgcaatga taccgcgaga cccacgctca ccggctccag atttatcagc

     6241 aataaaccag ccagccggaa gggccgagcg cagaagtggt cctgcaactt tatccgcctc

     6301 catccagtct attaattgtt gccgggaagc tagagtaagt agttcgccag ttaatagttt

     6361 gcgcaacgtt gttgccattg ctacaggcat cgtggtgtca cgctcgtcgt ttggtatggc

     6421 ttcattcagc tccggttccc aacgatcaag gcgagttaca tgatccccca tgttgtgcaa

     6481 aaaagcggtt agctccttcg gtcctccgat cgttgtcaga agtaagttgg ccgcagtgtt

     6541 atcactcatg gttatggcag cactgcataa ttctcttact gtcatgccat ccgtaagatg

     6601 cttttctgtg actggtgagt actcaaccaa gtcattctga gaatagtgta tgcggcgacc

     6661 gagttgctct tgcccggcgt caatacggga taataccgcg ccacatagca gaactttaaa

     6721 agtgctcatc attggaaaac gttcttcggg gcgaaaactc tcaaggatct taccgctgtt

     6781 gagatccagt tcgatgtaac ccactcgtgc acccaactga tcttcagcat cttttacttt

     6841 caccagcgtt tctgggtgag caaaaacagg aaggcaaaat gccgcaaaaa agggaataag

     6901 ggcgacacgg aaatgttgaa tactcatact cttccttttt caatattatt gaagcattta

     6961 tcagggttat tgtctcatga gcggatacat atttgaatgt atttagaaaa ataaacaaat

     7021 aggggttccg cgcacatttc cccgaaaagt gccacctgaa cgaagcatct gtgcttcatt

     7081 ttgtagaaca aaaatgcaac gcgagagcgc taatttttca aacaaagaat ctgagctgca

     7141 tttttacaga acagaaatgc aacgcgaaag cgctatttta ccaacgaaga atctgtgctt

     7201 catttttgta aaacaaaaat gcaacgcgag agcgctaatt tttcaaacaa agaatctgag

     7261 ctgcattttt acagaacaga aatgcaacgc gagagcgcta ttttaccaac aaagaatcta

     7321 tacttctttt ttgttctaca aaaatgcatc ccgagagcgc tatttttcta acaaagcatc

     7381 ttagattact ttttttctcc tttgtgcgct ctataatgca gtctcttgat aactttttgc

     7441 actgtaggtc cgttaaggtt agaagaaggc tactttggtg tctattttct cttccataaa

     7501 aaaagcctga ctccacttcc cgcgtttact gattactagc gaagctgcgg gtgcattttt

     7561 tcaagataaa ggcatccccg attatattct ataccgatgt ggattgcgca tactttgtga

     7621 acagaaagtg atagcgttga tgattcttca ttggtcagaa aattatgaac ggtttcttct

     7681 attttgtctc tatatactac gtataggaaa tgtttacatt ttcgtattgt tttcgattca

     7741 ctctatgaat agttcttact acaatttttt tgtctaaaga gtaatactag agataaacat

     7801 aaaaaatgta gaggtcgagt ttagatgcaa gttcaaggag cgaaaggtgg atgggtaggt

     7861 tatataggga tatagcacag agatatatag caaagagata cttttgagca atgtttgtgg

     7921 aagcggtatt cgcaatattt tagtagctcg ttacagtccg gtgcgttttt ggttttttga

     7981 aagtgcgtct tcagagcgct tttggttttc aaaagcgctc tgaagttcct atactttcta

     8041 gagaatagga acttcggaat aggaacttca aagcgtttcc gaaaacgagc gcttccgaaa

     8101 atgcaacgcg agctgcgcac atacagctca ctgttcacgt cgcacctata tctgcgtgtt

     8161 gcctgtatat atatatacat gagaagaacg gcatagtgcg tgtttatgct taaatgcgta

     8221 cttatatgcg tctatttatg taggatgaaa ggtagtctag tacctcctgt gatattatcc

     8281 cattccatgc ggggtatcgt atgcttcctt cagcactacc ctttagctgt tctatatgct

     8341 gccactcctc aattggatta gtctcatcct tcaatgctat catttccttt gatattggat

     8401 catactaaga aaccattatt atcatgacat taacctataa aaataggcgt atcacgaggc

     8461 cctttcgtct cgcgcgtttc ggtgatgacg gtgaaaacct ctgacacatg cagctcccgg

     8521 agacggtcac agcttgtctg taagcggatg ccgggagcag acaagcccgt cagggcgcgt

     8581 cagcgggtgt tggcgggtgt cggggctggc ttaactatgc ggcatcagag cagattgtac

     8641 tgagagtgca ccataccacc ttttcaattc atcatttttt ttttattctt ttttttgatt

     8701 tcggtttcct tgaaattttt ttgattcggt aatctccgaa cagaaggaag aacgaaggaa

     8761 ggagcacaga cttagattgg tatatatacg catatgtagt gttgaagaaa catgaaattg

     8821 cccagtattc ttaacccaac tgcacagaac aaaaacctgc aggaaacgaa gataaatcat

     8881 gtcgaaagct acatataagg aacgtgctgc tactcatcct agtcctgttg ctgccaagct

     8941 atttaatatc atgcacgaaa agcaaacaaa cttgtgtgct tcattggatg ttcgtaccac

     9001 caaggaatta ctggagttag ttgaagcatt aggtcccaaa atttgtttac taaaaacaca

     9061 tgtggatatc ttgactgatt tttccatgga gggcacagtt aagccgctaa aggcattatc

     9121 cgccaagtac aattttttac tcttcgaaga cagaaaattt gctgacattg gtaatacagt

     9181 caaattgcag tactctgcgg gtgtatacag aatagcagaa tgggcagaca ttacgaatgc

     9241 acacggtgtg gtgggcccag gtattgttag cggtttgaag caggcggcag aagaagtaac

     9301 aaaggaacct agaggccttt tgatgttagc agaattgtca tgcaagggct ccctatctac

     9361 tggagaatat actaagggta ctgttgacat tgcgaagagc gacaaagatt ttgttatcgg

     9421 ctttattgct caaagagaca tgggtggaag agatgaaggt tacgattggt tgattatgac

     9481 acccggtgtg ggtttagatg acaagggaga cgcattgggt caacagtata gaaccgtgga

     9541 tgatgtggtc tctacaggat ctgacattat tattgttgga agaggactat ttgcaaaggg

     9601 aagggatgct aaggtagagg gtgaacgtta cagaaaagca ggctgggaag catatttgag

     9661 aagatgcggc cagcaaaact aaaaaactgt attataagta aatgcatgta tactaaactc

     9721 acaaattaga gcttcaattt aattatatca gttattaccc tatgcggtgt gaaataccgc

     9781 acagatgcgt aaggagaaaa taccgcatca ggaaattgta agcgttaata ttttgttaaa

     9841 attcgcgtta aatttttgtt aaatcagctc attttttaac caataggccg aaatcggcaa

     9901 aatcccttat aaatcaaaag aatagaccga gatagggttg agtgttgttc cagtttggaa

     9961 caagagtcca ctattaaaga acgtggactc caacgtcaaa gggcgaaaaa ccgtctatca

    10021 gggcgatggc ccactacgtg aaccatcacc ctaatcaagt tttttggggt cgaggtgccg

    10081 taaagcacta aatcggaacc ctaaagggag cccccgattt agagcttgac ggggaaagcc

    10141 ggcgaacgtg gcgagaaagg aagggaagaa agcgaaagga gcgggcgcta gggcgctggc

    10201 aagtgtagcg gtcacgctgc gcgtaaccac cacacccgcc gcgcttaatg cgccgctaca

    10261 gggcgcgtcc attcgccatt caggctgcgc aactgttggg aagggcgatc ggtgcgggcc

    10321 tcttcgctat tacgccagct ggcgaaaggg ggatgtgctg caaggcgatt aagttgggta

    10381 acgccagggt tttcccagtc acgacgttgt aaaacgacgg ccagtgagcg cgcgtaatac

    10441 gactcactat agggcgaatt gggtaccggg ccccccctcg aggtcgacgg tatcgataag

    10501 cttgatatcg aattcagtct actagtcagt tcgagtttat cattatcaat actgccattt

    10561 caaagaatac gtaaataatt aatagtagtg attttcctaa ctttatttag tcaaaaaatt

    10621 agccttttaa ttctgctgta acccgtacat gcccaaaata gggggcgggt tacacagaat

    10681 atataacatc gtaggtgtct gggtgaacag tttattcctg gcatccacta aatataatgg

    10741 agcccgcttt ttaagctggc atccagaaaa aaaaagaatc ccagcaccaa aatattgttt

    10801 tcttcaccaa ccatcagttc ataggtccat tctcttagcg caactacaga gaacaggggc

    10861 acaaacaggc aaaaaacggg cacaacctca atggagtgat gcaacctgcc tggagtaaat

    10921 gatgacacaa ggcaattgac ccacgcatgt atctatctca ttttcttaca ccttctatta

    10981 ccttctgctc tctctgattt ggaaaaagct gaaaaaaaag gttgaaacca gttccctgaa

    11041 attattcccc tacttgacta ataagtatat aaagacggta ggtattgatt gtaattctgt

    11101 aaatctattt cttaaacttc ttaaattcta cttttatagt tagtcttttt tttagtttta

    11161 aaacaccaag aacttagttt cgaataaaca cacataaaca aacaaaagat ctgatatgga

    11221 tcgaattaga tctcgccacc

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart