pMP2444

$260.00

  • Model: PVT11378
  • 50 Units in Stock
Ask a question


Add to Cart:

pMP2444


Catalog No. PVT11378
Packing 2ug
 

pMP2444 Information

Prokaryotic resistance: Gentamicin Gen

Cloning strain: Escherichia coli DH5alpha

Culture conditions: 37 C

 

pMP2444 Description

PMP2444 is a wide host prokaryotic green fluorescent protein expression plasmid.

 

pMP2444 Multiple cloning sites

pMP2444-vector

 

pMP2444 Sequence

LOCUS       Exported                5471 bp ds-DNA     circular SYN 04-DEC-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..5471
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             complement(261..794)
                     /codon_start=1
                     /gene="aacC1"
                     /product="gentamycin acetyltransferase"
                     /label=Gen
                     /note="confers resistance to gentamycin"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
                     LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
                     EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
                     EEVMHFDIDPSTAT"
     promoter        complement(983..1011)
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     protein_bind    1281..1302
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        1317..1347
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1355..1371
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        1416..1434
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    1447..1518
                     /label=MCS
     CDS             1520..2239
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     CDS             complement(3017..3679)
                     /codon_start=1
                     /product="replication protein for the broad-host-range 
                     plasmid pBBR1 from Bordetella bronchiseptica"
                     /label=pBBR1 Rep
                     /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
                     HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
                     NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
                     PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
     rep_origin      3680..4449
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
ORIGIN
        1 accttcggga gcgcctgaag cccgttctgg acgccctggg gccgttgaat cgggatatgc
       61 aggccaaggc cgccgcgatc atcaaggccg tgggcgaaaa gctgctgacg gaacagcggg
      121 aagtccagcg ccagaaacag gcccagcgcc agcaggaacg cgggcgcgca catttccccg
      181 aaaagtgcca cctggcggcg ttgtgacaat ttaccgaaca actccgcggc cgggaagccg
      241 atctcggctt gaacgaattg ttaggtggcg gtacttgggt cgatatcaaa gtgcatcact
      301 tcttcccgta tgcccaactt tgtatagaga gccactgcgg gatcgtcacc gtaatctgct
      361 tgcacgtaga tcacataagc accaagcgcg ttggcctcat gcttgaggag attgatgagc
      421 gcggtggcaa tgccctgcct ccggtgctcg ccggagactg cgagatcata gatatagatc
      481 tcactacgcg gctgctcaaa cctgggcaga acgtaagccg cgagagcgcc aacaaccgct
      541 tcttggtcga aggcagcaag cgcgatgaat gtcttactac ggagcaagtt cccgaggtaa
      601 tcggagtccg gctgatgttg ggagtaggtg gctacgtctc cgaactcacg accgaaaaga
      661 tcaagagcag cccgcatgga tttgacttgg tcagggccga gcctacatgt gcgaatgatg
      721 cccatacttg agccacctaa ctttgtttta gggcgactgc cctgctgcgt aacatcgttg
      781 ctgctgcgta acatcgttgc tgctccataa catcaaacat cgacccacgg cgtaacgcgc
      841 ttgctgcttg gatgcccgag gcatagactg tacaaaaaaa cagtcataac aagccatgaa
      901 aaccgccact gcgccgttac caccgctgcg ttcggtcaag gttctggacc agttgcgtga
      961 gcgcatacgc tacttgcatt acagtttacg aaccgaacag gcttatgtca actgggttcg
     1021 tgccttcatc cgtttccacg gtgtgcgtcc atgggcaaat attatacgca aggcgacaag
     1081 gtgctgatgc cgctggcgat tcaggttcat catgccgttt gtgatggctt ccatgtcggc
     1141 agaatgctta atgaattaca acagttttta tgcatgcgcc caatacgcaa accgcctctc
     1201 cccgcgcgtt ggccgattca ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg
     1261 ggcagtgagc gcaacgcaat taatgtgagt tagctcactc attaggcacc ccaggcttta
     1321 cactttatgc ttccggctcg tatgttgtgt ggaattgtga gcggataaca atttcacaca
     1381 ggaaacagct atgaccatga ttacgccaag cgcgcaatta accctcacta aagggaacaa
     1441 aagctgggta ccgggccccc cctcgaggtc gacggtatcg ataagcttga tatcgaattc
     1501 ctgcagcccg ggggatccaa tggtgagcaa gggcgaggag ctgttcaccg gggtggtgcc
     1561 catcctggtc gagctggacg gcgacgtaaa cggccacaag ttcagcgtgt ccggcgaggg
     1621 cgagggcgat gccacctacg gcaagctgac cctgaagttc atctgcacca ccggcaagct
     1681 gcccgtgccc tggcccaccc tcgtgaccac cctgacctac ggcgtgcagt gcttcagccg
     1741 ctaccccgac cacatgaagc agcacgactt cttcaagtcc gccatgcccg aaggctacgt
     1801 ccaggagcgc accatcttct tcaaggacga cggcaactac aagacccgcg ccgaggtgaa
     1861 gttcgagggc gacaccctgg tgaaccgcat cgagctgaag ggcatcgact tcaaggagga
     1921 cggcaacatc ctggggcaca agctggagta caactacaac agccacaacg tctatatcat
     1981 ggccgacaag cagaagaacg gcatcaaggt gaacttcaag atccgccaca acatcgagga
     2041 cggcagcgtg cagctcgccg accactacca gcagaacacc cccatcggcg acggccccgt
     2101 gctgctgccc gacaaccact acctgagcac ccagtccgcc ctgagcaaag accccaacga
     2161 gaagcgcgat cacatggtcc tgctggagtt cgtgaccgcc gccgggatca ctctcggcat
     2221 ggacgagctg tacaagtagt ctagattagt ggagctccaa ttcgccctat agtgagtcgt
     2281 attacgcgcg ctcactggcc gtcgttttac aacgtcgtga ctgggaaaac cctggcgtta
     2341 cccaacttaa tcgccttgca gcacatcccc ctttcgccag ctggcgtaat agcgaagagg
     2401 cccgcaccga tcgcccttcc caacagttgc gcagcctgaa tggcgaatgg aaat
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart