pMy- BirA- T2A- eGFP

$215.00

  • Model: PVT10519
  • 50 Units in Stock
Ask a question


Add to Cart:

pMy-BirA-T2A-eGFP


Catalog No. PVT10519
Packing 2ug

 

pMy-BirA-T2A-eGFP  Information

Function Protease plasmids

Replicon: PUC

Prokaryotic resistance: amp

Screening marker: green fluorescent protein EGFP

Clone strain: stbl3

Culture conditions: 37 degrees

Plasmid host:-

Use of plasmids:-

Fragment type: ORF

Fragment species:-

Prokaryotic resistance: amp

Eukaryotic resistance:-

Fluorescent label: Green

 

pMy-BirA-T2A-eGFP Description

PMy-BirA-T2A-eGFP is a biotinylase retroviral expression plasmid.

 

pMy-BirA-T2A-eGFP Sequence

LOCUS       Exported                6380 bp ds-DNA     circular SYN 07-AUG-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..6380

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             1090..1506

                     /label=gag (truncated)

     misc_feature    1516..1890

                     /label=pol region

     CDS             1905..2867

                     /codon_start=1

                     /label=BirA

                     /translation="MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRD

                     WGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSG

                     DACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRK

                     LGADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQG

                     WITLQEAGINLDRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIG

                     DKEIFGISRGIDKQGALLLEQDGIIKPWMGGEISLRSAEK"

     CDS             2868..2921

                     /codon_start=1

                     /label=T2A

                     /translation="EGRGSLLTCGDVEENPGP"

     CDS             2922..3641

                     /codon_start=1

                     /label=EGFP

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     rep_origin      complement(4655..5243)

                     /direction=LEFT

                     /label=ori

     CDS             complement(5407..6267)

                     /codon_start=1

                     /label=AmpR

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(6268..6372)

                     /label=AmpR promoter

ORIGIN

        1 ctgcataatg aaagacccca cctgtaggtt tggcaagcta gcttaagtaa cgccattttg

       61 caaggcatgg aaaaatacat aactgagaat agaaaagttc agatcaaggt caggaacaga

      121 tggaacagct gaatatgggc caaagcggat atctgtggta agcagttcct gccccggctc

      181 agggccaaga acagatggaa cagctgaata tgggccaaac aggatatctg tggtaagcag

      241 ttcctgcccc ggctcagggc caagaacaga tggtccccag atgcggtcca gccctcagca

      301 gtttctagag aaccatcaga tgtttccagg gtgccccaag gacctgaaat gaccctgtgc

      361 cttatttgaa ctaaccaatc agttcgcttc tcgcttctgt tcgcgcgctt ctgctccccg

      421 agctcaataa aagagcccac aacccctcac tcggggcgcc agtcctccga ttgactgagt

      481 cgcccgggta cccgtattcc caataaagcc tcttgctgtt tgcatccgaa tcgtggactc

      541 gctgatcctt gggagggtct cctcagattg attgactgcc cacctcgggg gtctttcatt

      601 tggaggttcc accgagattt ggagacccca gcccagggac caccgacccc cccgccggga

      661 ggtaagctgg ccagcggtcg tttcgtgtct gtctctgtct ttgtgcgtgt ttgtgccggc

      721 atctaatgtt tgcgcctgcg tctgtactag ttagctaact agctctgtat ctggcggacc

      781 cgtggtggaa ctgacgagtt cggaacaccc ggccgcaacc ctgggagacg tcccaggtcg

      841 ggggccgttt ttgtggcccg acctgagtcc aaaaagcccg atcgttttgg actctttggt

      901 gcacccccct tagaggaggg atatgtggtt ctggtaggag acgagaacct aaaacagttc

      961 ccgcctccgt ctgaattttt gctttcggtt tgggaccgaa gccgcgccgc gcgtcttgtc

     1021 tgctgcagca tcgttctgtg ttgtctctgt ctgactgtgt ttctgtattt gtctgaaaat

     1081 atgggcccgg gccagactgt taccactccc ttaagtttga ccttaggtca ctggaaagat

     1141 gtcgagcgga tcgctcacaa ccagtcggta gatgtcaaga agagacgttg ggttaccttc

     1201 tgctctgcag aatggccaac ctttaacgtc ggatggccgc gagacggcac ctttaaccga

     1261 gacctcatca cccaggttaa gatcaaggtc ttttcacctg gcccgcatgg acacccagac

     1321 caggtcccct acatcgtgac ctgggaagcc ttggcttttg acccccctcc ctgggtcaag

     1381 ccctttgtac accctaagcc tccgcctcct cttcctccat ccgccccgtc tctccccctt

     1441 gaacctcctc gttcgacccc gcctcgatcc tccctttatc cagccctcac tccttctcta

     1501 ggcgccccca tatggccata tgagatctta tatggggcac ccccgcccct tgtaaacttc

     1561 cctgaccctg acatgacaag agttactaac agcccctctc tccaagctca cttacaggct

     1621 ctctacttag tccagcacga agtctggaga cctctggcgg cagcctacca agaacaactg

     1681 gaccgaccgg tggtacctca cccttaccga gtcggcgaca cagtgtgggt ccgccgacac

     1741 cagactaaga acctagaacc tcgctggaaa ggaccttaca cagtcctgct gaccaccccc

     1801 accgccctca aagtagacgg catcgcagct tggatacacg ccgcccacgt gaaggctgcc

     1861 gaccccgggg gtggaccatc ctctagactg ccggatccgc caccatgaag gataacaccg

     1921 tgccactgaa attgattgcc ctgttagcga acggtgaatt tcactctggc gagcagttgg

     1981 gtgaaacgct gggaatgagc cgggcggcta ttaataaaca cattcagaca ctgcgtgact

     2041 ggggcgttga tgtctttacc gttccgggta aaggatacag cctgcctgag cctatccagt

     2101 tacttaatgc taaacagata ttgggtcagc tggatggcgg tagtgtagcc gtgctgccag

     2161 tgattgactc cacgaatcag taccttcttg atcgtatcgg agagcttaaa tcgggcgatg

     2221 cttgcattgc agaataccag caggctggcc gtggtcgccg gggtcggaaa tggttttcgc

     2281 cttttggcgc aaacttatat ttgtcgatgt tctggcgtct ggaacaaggc ccggcggcgg

     2341 cgattggttt aagtctggtt atcggtatcg tgatggcgga agtattacgc aagctgggtg

     2401 cagataaagt tcgtgttaaa tggcctaatg acctctatct gcaggatcgc aagctggcag

     2461 gcattctggt ggagctgact ggcaaaactg gcgatgcggc gcaaatagtc attggagccg

     2521 ggatcaacat ggcaatgcgc cgtgttgaag agagtgtcgt taatcagggg tggatcacgc

     2581 tgcaggaagc ggggatcaat ctcgatcgta atacgttggc ggccatgcta atacgtgaat

     2641 tacgtgctgc gttggaactc ttcgaacaag aaggattggc accttatctg tcgcgctggg

     2701 aaaagctgga taattttatt aatcgcccag tgaaacttat cattggtgat aaagaaatat

     2761 ttggcatttc acgcggaata gacaaacagg gggctttatt acttgagcag gatggaataa

     2821 taaaaccctg gatgggcggt gaaatatcct tgcgtagtgc agaaaaagag ggcagaggaa

     2881 gtcttctaac atgcggtgac gtggaggaga atcccggccc tatggtgagc aagggcgagg

     2941 agctgttcac cggggtggtg cccatcctgg tcgagctgga cggcgacgta aacggccaca

     3001 agttcagcgt gtccggcgag ggcgagggcg atgccaccta cggcaagctg accctgaagt

     3061 tcatctgcac caccggcaag ctgcccgtgc cctggcccac cctcgtgacc accctgacct

     3121 acggcgtgca gtgcttcagc cgctaccccg accacatgaa gcagcacgac ttcttcaagt

     3181 ccgccatgcc cgaaggctac gtccaggagc gcaccatctt cttcaaggac gacggcaact

     3241 acaagacccg cgccgaggtg aagttcgagg gcgacaccct ggtgaaccgc atcgagctga

     3301 agggcatcga cttcaaggag gacggcaaca tcctggggca caagctggag tacaactaca

     3361 acagccacaa cgtctatatc atggccgaca agcagaagaa cggcatcaag gtgaacttca

     3421 agatccgcca caacatcgag gacggcagcg tgcagctcgc cgaccactac cagcagaaca

     3481 cccccatcgg cgacggcccc gtgctgctgc ccgacaacca ctacctgagc acccagtccg

     3541 ccctgagcaa agaccccaac gagaagcgcg atcacatggt cctgctggag ttcgtgaccg

     3601 ccgccgggat cactctcggc atggacgagc tgtacaagta aactcgacat ttcgaccggg

     3661 ccgccagcac agtggggggg ggcccgcgat tagtccaatt tgttaaagac aggatatcag

     3721 tggtccaggc tctagttttg actcaacaat atcaccagct gaagcctata gagtacgagc

     3781 catagataga ataaaagatt ttatttagtc tccagaaaaa ggggggaatg aaagacccca

     3841 cctgtaggtt tggcaagcta gcttaagtaa gccattttgc aaggcatgga aaaatacata

     3901 actgagaata gagaagttca gatcaaggtt aggaacagag agacaggaga atatgggcca

     3961 aacaggatat ctgtggtaag cagttcctgc cccggctcag ggccaagaac agttggaaca

     4021 gcagaatatg ggccaaacag gatatctgtg gtaagcagtt cctgccccgg ctcagggcca

     4081 agaacagatg gtccccagat gcggtcccgc cctcagcagt ttctagagaa ccatcagatg

     4141 tttccagggt gccccaagga cctgaaatga ccctgtgcct tatttgaact aaccaatcag

     4201 ttcgcttctc gcttctgttc gcgcgcttct gctccccgag ctcaataaaa gagcccacaa

     4261 cccctcactc ggcgcgccag tcctccgata gactgcgtcg cccgggtacc cgtgtatcca

     4321 ataaaccctc ttgcagttgc atccgacttg tggtctcgct gttccttggg agggtctcct

     4381 ctgagtgatt gactacccgt cagcgggggt ctttcattct gcattaatga atcggccaac

     4441 gcgcggggag aggcggtttg cgtattgggc gctcttccgc ttcctcgctc actgactcgc

     4501 tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg gtaatacggt

     4561 tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc cagcaaaagg

     4621 ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc ccccctgacg

     4681 agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga ctataaagat

     4741 accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc ctgccgctta

     4801 ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat agctcacgct

     4861 gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg cacgaacccc

     4921 ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc aacccggtaa

     4981 gacacgactt atagccactg gcagcagcca ctggtaacag gattagcaga gcgaggtatg

     5041 taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact agaaggacag

     5101 tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt ggtagctctt

     5161 gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag cagcagatta

     5221 cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg tctgacgctc

     5281 agtggaacga aaactcacgt taagggattt tggtcatgag attatcaaaa aggatcttca

     5341 cctagatcct tttgcggccg gccgcaaatc aatctaaagt atatatgagt aaacttggtc

     5401 tgacagttac caatgcttaa tcagtgaggc acctatctca gcgatctgtc tatttcgttc

     5461 atccatagtt gcctgactcc ccgtcgtgta gataactacg atacgggagg gcttaccatc

     5521 tggccccagt gctgcaatga taccgcgaga cccacgctca ccggctccag atttatcagc

     5581 aataaaccag ccagccggaa gggccgagcg cagaagtggt cctgcaactt tatccgcctc

     5641 catccagtct attaattgtt gccgggaagc tagagtaagt agttcgccag ttaatagttt

     5701 gcgcaacgtt gttgccattg ctacaggcat cgtggtgtca cgctcgtcgt ttggtatggc

     5761 ttcattcagc tccggttccc aacgatcaag gcgagttaca tgatccccca tgttgtgcaa

     5821 aaaagcggtt agctccttcg gtcctccgat cgttgtcaga agtaagttgg ccgcagtgtt

     5881 atcactcatg gttatggcag cactgcataa ttctcttact gtcatgccat ccgtaagatg

     5941 cttttctgtg actggtgagt actcaaccaa gtcattctga gaatagtgta tgcggcgacc

     6001 gagttgctct tgcccggcgt caacacggga taataccgcg ccacatagca gaactttaaa

     6061 agtgctcatc attggaaaac gttcttcggg gcgaaaactc tcaaggatct taccgctgtt

     6121 gagatccagt tcgatgtaac ccactcgtgc acccaactga tcttcagcat cttttacttt

     6181 caccagcgtt tctgggtgag caaaaacagg aaggcaaaat gccgcaaaaa agggaataag

     6241 ggcgacacgg aaatgttgaa tactcatact cttccttttt caatattatt gaagcattta

     6301 tcagggttat tgtctcatga gcggatacat atttgaatgt atttagaaaa ataaacaaat

     6361 aggggttccg cgcacatttc

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart