pMy- BirA- T2A- eGFP

$193.00

  • Model: PVT10519
  • 50 Units in Stock
Ask a question


Add to Cart:

pMy-BirA-T2A-eGFP


Catalog No. PVT10519
Packing 2ug

 

pMy-BirA-T2A-eGFP  Information

Function Protease plasmids
Screen EGFP
Strain Stbl3
Replicon pUC

 

Promoter: Tac/Laco

Plasmid classification: Escherichia coli vector; pMal series expression plasmid

Prokaryotic resistance: ampicillin Amp

Clone strain: Escherichia coli DH5 alpha

Culture conditions: 37 C

 

pMy-BirA-T2A-eGFP Description

PMy-BirA-T2A-eGFP is a biotinylase retroviral expression plasmid.

 

pMy-BirA-T2A-eGFP Sequence

LOCUS       Exported                6380 bp ds-DNA     circular SYN 07-AUG-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..6380
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1090..1506
                     /label=gag (truncated)
     misc_feature    1516..1890
                     /label=pol region
     CDS             1905..2867
                     /codon_start=1
                     /label=BirA
                     /translation="MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRD
                     WGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSG
                     DACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRK
                     LGADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQG
                     WITLQEAGINLDRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIG
                     DKEIFGISRGIDKQGALLLEQDGIIKPWMGGEISLRSAEK"
     CDS             2868..2921
                     /codon_start=1
                     /label=T2A
                     /translation="EGRGSLLTCGDVEENPGP"
     CDS             2922..3641
                     /codon_start=1
                     /label=EGFP
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     rep_origin      complement(4655..5243)
                     /direction=LEFT
                     /label=ori
     CDS             complement(5407..6267)
                     /codon_start=1
                     /label=AmpR
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(6268..6372)
                     /label=AmpR promoter
ORIGIN
        1 ctgcataatg aaagacccca cctgtaggtt tggcaagcta gcttaagtaa cgccattttg
       61 caaggcatgg aaaaatacat aactgagaat agaaaagttc agatcaaggt caggaacaga
      121 tggaacagct gaatatgggc caaagcggat atctgtggta agcagttcct gccccggctc
      181 agggccaaga acagatggaa cagctgaata tgggccaaac aggatatctg tggtaagcag
      241 ttcctgcccc ggctcagggc caagaacaga tggtccccag atgcggtcca gccctcagca
      301 gtttctagag aaccatcaga tgtttccagg gtgccccaag gacctgaaat gaccctgtgc
      361 cttatttgaa ctaaccaatc agttcgcttc tcgcttctgt tcgcgcgctt ctgctccccg
      421 agctcaataa aagagcccac aacccctcac tcggggcgcc agtcctccga ttgactgagt
      481 cgcccgggta cccgtattcc caataaagcc tcttgctgtt tgcatccgaa tcgtggactc
      541 gctgatcctt gggagggtct cctcagattg attgactgcc cacctcgggg gtctttcatt
      601 tggaggttcc accgagattt ggagacccca gcccagggac caccgacccc cccgccggga
      661 ggtaagctgg ccagcggtcg tttcgtgtct gtctctgtct ttgtgcgtgt ttgtgccggc
      721 atctaatgtt tgcgcctgcg tctgtactag ttagctaact agctctgtat ctggcggacc
      781 cgtggtggaa ctgacgagtt cggaacaccc ggccgcaacc ctgggagacg tcccaggtcg
      841 ggggccgttt ttgtggcccg acctgagtcc aaaaagcccg atcgttttgg actctttggt
      901 gcacccccct tagaggaggg atatgtggtt ctggtaggag acgagaacct aaaacagttc
      961 ccgcctccgt ctgaattttt gctttcggtt tgggaccgaa gccgcgccgc gcgtcttgtc
     1021 tgctgcagca tcgttctgtg ttgtctctgt ctgactgtgt ttctgtattt gtctgaaaat
     1081 atgggcccgg gccagactgt taccactccc ttaagtttga ccttaggtca ctggaaagat
     1141 gtcgagcgga tcgctcacaa ccagtcggta gatgtcaaga agagacgttg ggttaccttc
     1201 tgctctgcag aatggccaac ctttaacgtc ggatggccgc gagacggcac ctttaaccga
     1261 gacctcatca cccaggttaa gatcaaggtc ttttcacctg gcccgcatgg acacccagac
     1321 caggtcccct acatcgtgac ctgggaagcc ttggcttttg acccccctcc ctgggtcaag
     1381 ccctttgtac accctaagcc tccgcctcct cttcctccat ccgccccgtc tctccccctt
     1441 gaacctcctc gttcgacccc gcctcgatcc tccctttatc cagccctcac tccttctcta
     1501 ggcgccccca tatggccata tgagatctta tatggggcac ccccgcccct tgtaaacttc
     1561 cctgaccctg acatgacaag agttactaac agcccctctc tccaagctca cttacaggct
     1621 ctctacttag tccagcacga agtctggaga cctctggcgg cagcctacca agaacaactg
     1681 gaccgaccgg tggtacctca cccttaccga gtcggcgaca cagtgtgggt ccgccgacac
     1741 cagactaaga acctagaacc tcgctggaaa ggaccttaca cagtcctgct gaccaccccc
     1801 accgccctca aagtagacgg catcgcagct tggatacacg ccgcccacgt gaaggctgcc
     1861 gaccccgggg gtggaccatc ctctagactg ccggatccgc caccatgaag gataacaccg
     1921 tgccactgaa attgattgcc ctgttagcga acggtgaatt tcactctggc gagcagttgg
     1981 gtgaaacgct gggaatgagc cgggcggcta ttaataaaca cattcagaca ctgcgtgact
     2041 ggggcgttga tgtctttacc gttccgggta aaggatacag cctgcctgag cctatccagt
     2101 tacttaatgc taaacagata ttgggtcagc tggatggcgg tagtgtagcc gtgctgccag
     2161 tgattgactc cacgaatcag taccttcttg atcgtatcgg agagcttaaa tcgggcgatg
     2221 cttgcattgc agaataccag caggctggcc gtggtcgccg gggtcggaaa tggttttcgc
     2281 cttttggcgc aaacttatat ttgtcgatgt tctggcgtct ggaacaaggc ccggcggcgg
     2341 cgattggttt aagtctggtt atcggtatcg tgatggcgga agtattacgc aagctgggtg
     2401 cagataaagt tcgtgttaaa tggcctaatg acctctatct gcaggatcgc aagctggcag
     2461 gcattctggt ggagctgact ggcaaaactg gcgatgcggc gcaaatagtc attggagccg
     2521 ggatcaacat ggcaatgcgc cgtgttgaag agagtgtcgt taatcagggg tggatcacgc
     2581 tgcaggaagc ggggatcaat ctcgatcgta atacgttggc ggccatgcta atacgtgaat
     2641 tacgtgctgc gttggaactc ttcgaacaag aaggattggc accttatctg tcgcgctggg
     2701 aaaagctgga taattttatt aatcgcccag tgaaacttat cattggtgat aaagaaatat
     2761 ttggcatttc acgcggaata gacaaacagg gggctttatt acttgagcag gatggaataa
     2821 taaaaccctg gatgggcggt gaaatatcct tgcgtagtgc agaaaaagag ggcagaggaa
     2881 gtcttctaac atgcggtgac gtggaggaga atcccggccc tatggtgagc aagggcgagg
     2941 agctgttcac cggggtggtg cccatcctgg tcgagctgga cggcgacgta aacggccaca
     3001 agttcagcgt gtccggcgag ggcgagggcg atgccaccta cggcaagctg accctgaagt
     3061 tcatctgcac caccggcaag ctgcccgtgc cctggcccac cctcgtgacc accctgacct
     3121 acggcgtgca gtgcttcagc cgctaccccg accacatgaa gcagcacgac ttcttcaagt
     3181 ccgccatgcc cgaaggctac gtccaggagc gcaccatctt cttcaaggac gacggcaact
     3241 acaagacccg cgccgaggtg aagttcgagg gcgacaccct ggtgaaccgc atcgagctga
     3301 agggcatcga cttcaaggag gacggcaaca tcctggggca caagctggag tacaactaca
     3361 acagccacaa cgtctatatc atggccgaca agcagaagaa cggcatcaag gtgaacttca
     3421 agatccgcca caacatcgag gacggcagcg tgcagctcgc cgaccactac cagcagaaca
     3481 cccccatcgg cgacggcccc gtgctgctgc ccgacaacca ctacctgagc acccagtccg
     3541 ccctgagcaa agaccccaac gagaagcgcg atcacatggt cctgctggag ttcgtgaccg
     3601 ccgccgggat cactctcggc atggacgagc tgtacaagta aactcgacat ttcgaccggg
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart