pMyosin- PSmOrange

$215.00

  • Model: PVT10786
  • 50 Units in Stock
Ask a question


Add to Cart:

pMyosin-PSmOrange


Catalog No. PVT10786
Packing 2ug
Function Mammalian fluorescent plasmid
Resistance Kan
Screen Neo/G418
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pUC
Copy
Promoter CMV
Induction --
Forward primer CMV-F
Reverse primer Sv40-polyA-R
Size 5210bp

 

pMyosin-PSmOrange Description

PMyosin-PSmOrange resistance is Kan, the screening marker is G418, which belongs to mammalian cells. It is a carrier that extends from pN1.

 

pMyosin-PSmOrange Multiple cloning site

pMyosin-PSmOrange-vector

 

 

pMyosin-PSmOrange Sequence
 

LOCUS       Exported                5210 bp ds-DNA     circular SYN 02-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5210)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Friday, September 2, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..5210

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        61..364

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        365..568

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     CDS             1165..1875

                     /codon_start=1

                     /product="orange to far-red photoswitchable variant of the 

                     monomeric fluorescent protein mOrange (Subach et al., 

                     2011)"

                     /note="PSmOrange"

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEENNMAIIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEG

                     FQTAKLKVTKGGPLPFAWDILSPLFTYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNY

                     EDGGVVTVTQDSSLQDGEFIYKVKMRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK

                     GEIRMRLKLKDGGHYTSEVKTTYKAKKSVQLPGAYIVGIKLDITSHNEDYTIVEQYERA

                     EGRHSTGGMDELYK"

     polyA_signal    1998..2119

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(2126..2581)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2608..2712

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        2714..3071

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      2922..3057

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     CDS             3106..3900

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     polyA_signal    4132..4179

                     /note="HSV TK poly(A) signal"

                     /note="herpes simplex virus thymidine kinase 

                     polyadenylation signal (Cole and Stacy, 1985)"

     rep_origin      4508..5096

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg

       61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt

      121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca

      181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc

      241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta

      301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac

      361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg

      421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg

      481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt

      541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta

      601 ccggactcag atctcgagct caagcttatg tcgagcaaga gagccaaggc caagaccacc

      661 aagaagaggc cccagagggc tacgtccaat gtcttcgcca tgtttgacca gtcccagatc

      721 caggagttta aggaggcctt caacatgatt gatcagaacc gcgatggctt cattgataag

      781 gaggacctgc acgacatgtt ggcctctctg gggaagaacc ccacagacga gtacctggag

      841 ggcatgatga acgaggcgcc agggcccatc aacttcacca tgttcctcac aatgtttggg

      901 gagaagctga acggcacaga ccccgaggat gtgatccgca atgcctttgc ctgctttgat

      961 gaggaggcct caggcttcat ccacgaggac cacctgaggg agctgctcac caccatgggc

     1021 gaccgattca cggatgagga ggtggacgag atgtaccgcg aggcacccat tgataagaag

     1081 ggcaacttca actacgtgga gttcactcgc atcctcaaac acggcgccaa ggacaaggac

     1141 gacctggatc caccggtcgc caccatggtg agcaagggcg aggagaataa tatggccatc

     1201 atcaaggagt tcatgcgctt caaggtgcgc atggagggca ccgtgaacgg ccacgagttc

     1261 gagatcgagg gcgagggcga gggccgcccc tacgagggct ttcagaccgc taagctgaag

     1321 gtgaccaagg gcggccccct gcccttcgcc tgggacatcc tgtcccctct cttcacctac

     1381 ggctccaagg cctacgtgaa gcaccccgcc gacatccccg actacttcaa gctgtccttc

     1441 cccgagggct tcaagtggga gcgcgtgatg aactacgagg acggcggcgt ggtgaccgtg

     1501 acccaggact cctcactgca ggacggcgag ttcatctaca aggtgaagat gcgcggcacc

     1561 aacttcccct ccgacggccc cgtgatgcag aagaagacca tgggctggga ggcctcctcc

     1621 gagcggatgt accccgagga cggcgccctg aagggcgaga tcaggatgag gctgaagctg

     1681 aaggacggcg gccactacac ctccgaggtc aagaccacct acaaggccaa gaagtccgtg

     1741 cagctgcccg gcgcctacat cgtcggcatc aagctggaca tcacctccca caacgaggac

     1801 tacaccatcg tggaacagta cgaacgcgcc gagggccgcc actccaccgg cggcatggac

     1861 gagctgtaca agtaaagcgg ccgcgactct agatcataat cagccatacc acatttgtag

     1921 aggttttact tgctttaaaa aacctcccac acctccccct gaacctgaaa cataaaatga

     1981 atgcaattgt tgttgttaac ttgtttattg cagcttataa tggttacaaa taaagcaata

     2041 gcatcacaaa tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca

     2101 aactcatcaa tgtatcttaa ggcgtaaatt gtaagcgtta atattttgtt aaaattcgcg

     2161 ttaaattttt gttaaatcag ctcatttttt aaccaatagg ccgaaatcgg caaaatccct

     2221 tataaatcaa aagaatagac cgagataggg ttgagtgttg ttccagtttg gaacaagagt

     2281 ccactattaa agaacgtgga ctccaacgtc aaagggcgaa aaaccgtcta tcagggcgat

     2341 ggcccactac gtgaaccatc accctaatca agttttttgg ggtcgaggtg ccgtaaagca

     2401 ctaaatcgga accctaaagg gagcccccga tttagagctt gacggggaaa gccggcgaac

     2461 gtggcgagaa aggaagggaa gaaagcgaaa ggagcgggcg ctagggcgct ggcaagtgta

     2521 gcggtcacgc tgcgcgtaac caccacaccc gccgcgctta atgcgccgct acagggcgcg

     2581 tcaggtggca cttttcgggg aaatgtgcgc ggaaccccta tttgtttatt tttctaaata

     2641 cattcaaata tgtatccgct catgagacaa taaccctgat aaatgcttca ataatattga

     2701 aaaaggaaga gtcctgaggc ggaaagaacc agctgtggaa tgtgtgtcag ttagggtgtg

     2761 gaaagtcccc aggctcccca gcaggcagaa gtatgcaaag catgcatctc aattagtcag

     2821 caaccaggtg tggaaagtcc ccaggctccc cagcaggcag aagtatgcaa agcatgcatc

     2881 tcaattagtc agcaaccata gtcccgcccc taactccgcc catcccgccc ctaactccgc

     2941 ccagttccgc ccattctccg ccccatggct gactaatttt ttttatttat gcagaggccg

     3001 aggccgcctc ggcctctgag ctattccaga agtagtgagg aggctttttt ggaggcctag

     3061 gcttttgcaa agatcgatca agagacagga tgaggatcgt ttcgcatgat tgaacaagat

     3121 ggattgcacg caggttctcc ggccgcttgg gtggagaggc tattcggcta tgactgggca

     3181 caacagacaa tcggctgctc tgatgccgcc gtgttccggc tgtcagcgca ggggcgcccg

     3241 gttctttttg tcaagaccga cctgtccggt gccctgaatg aactgcaaga cgaggcagcg

     3301 cggctatcgt ggctggccac gacgggcgtt ccttgcgcag ctgtgctcga cgttgtcact

     3361 gaagcgggaa gggactggct gctattgggc gaagtgccgg ggcaggatct cctgtcatct

     3421 caccttgctc ctgccgagaa agtatccatc atggctgatg caatgcggcg gctgcatacg

     3481 cttgatccgg ctacctgccc attcgaccac caagcgaaac atcgcatcga gcgagcacgt

     3541 actcggatgg aagccggtct tgtcgatcag gatgatctgg acgaagagca tcaggggctc

     3601 gcgccagccg aactgttcgc caggctcaag gcgagcatgc ccgacggcga ggatctcgtc

     3661 gtgacccatg gcgatgcctg cttgccgaat atcatggtgg aaaatggccg cttttctgga

     3721 ttcatcgact gtggccggct gggtgtggcg gaccgctatc aggacatagc gttggctacc

     3781 cgtgatattg ctgaagagct tggcggcgaa tgggctgacc gcttcctcgt gctttacggt

     3841 atcgccgctc ccgattcgca gcgcatcgcc ttctatcgcc ttcttgacga gttcttctga

     3901 gcgggactct ggggttcgaa atgaccgacc aagcgacgcc caacctgcca tcacgagatt

     3961 tcgattccac cgccgccttc tatgaaaggt tgggcttcgg aatcgttttc cgggacgccg

     4021 gctggatgat cctccagcgc ggggatctca tgctggagtt cttcgcccac cctaggggga

     4081 ggctaactga aacacggaag gagacaatac cggaaggaac ccgcgctatg acggcaataa

     4141 aaagacagaa taaaacgcac ggtgttgggt cgtttgttca taaacgcggg gttcggtccc

     4201 agggctggca ctctgtcgat accccaccga gaccccattg gggccaatac gcccgcgttt

     4261 cttccttttc cccaccccac cccccaagtt cgggtgaagg cccagggctc gcagccaacg

     4321 tcggggcggc aggccctgcc atagcctcag gttactcata tatactttag attgatttaa

     4381 aacttcattt ttaatttaaa aggatctagg tgaagatcct ttttgataat ctcatgacca

     4441 aaatccctta acgtgagttt tcgttccact gagcgtcaga ccccgtagaa aagatcaaag

     4501 gatcttcttg agatcctttt tttctgcgcg taatctgctg cttgcaaaca aaaaaaccac

     4561 cgctaccagc ggtggtttgt ttgccggatc aagagctacc aactcttttt ccgaaggtaa

     4621 ctggcttcag cagagcgcag ataccaaata ctgtccttct agtgtagccg tagttaggcc

     4681 accacttcaa gaactctgta gcaccgccta catacctcgc tctgctaatc ctgttaccag

     4741 tggctgctgc cagtggcgat aagtcgtgtc ttaccgggtt ggactcaaga cgatagttac

     4801 cggataaggc gcagcggtcg ggctgaacgg ggggttcgtg cacacagccc agcttggagc

     4861 gaacgaccta caccgaactg agatacctac agcgtgagct atgagaaagc gccacgcttc

     4921 ccgaagggag aaaggcggac aggtatccgg taagcggcag ggtcggaaca ggagagcgca

     4981 cgagggagct tccaggggga aacgcctggt atctttatag tcctgtcggg tttcgccacc

     5041 tctgacttga gcgtcgattt ttgtgatgct cgtcaggggg gcggagccta tggaaaaacg

     5101 ccagcaacgc ggccttttta cggttcctgg ccttttgctg gccttttgct cacatgttct

     5161 ttcctgcgtt atcccctgat tctgtggata accgtattac cgccatgcat

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart