pOJ260

$228.00

  • Model: PVT11373
  • 50 Units in Stock
Ask a question


Add to Cart:

pOJ260

PVT11373   Packing 2ug

 

pOJ260 Information

Prokaryotic resistance: amphotericin Apr

Clone strain: Escherichia coli DH5 alpha

Culture conditions: 37 C

 

 

pOJ260 Description

POJ260 is a Streptomyces gene knockout expression plasmid.

 

pOJ260 Sequence

LOCUS       Exported                3468 bp ds-DNA     circular SYN 13-DEC-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..3468
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             complement(169..507)
                     /codon_start=1
                     /gene="lacZ fragment"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /label=lacZ-alpha
                     /translation="MITNSISRAAADPLESTCSPSLALAVVLQRRDWENPGVTQLNRLA
                     AHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRINSPMSSTSGIG
                     SAADAKCR"
     misc_feature    443..499
                     /label=MCS
     promoter        complement(556..586)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     rep_origin      complement(910..1498)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             1702..2502
                     /codon_start=1
                     /gene="aac(3)IV"
                     /product="aminoglycoside 3-N-acetyltransferase type IV     
                               "
                     /label=ApmR
                     /note="confers resistance to apramycin (Paget and Davies, 
                     1996)"
                     /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP
                     LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV
                     KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH
                     LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH
                     AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG"
     oriT            2947..3056
                     /note="incP origin of transfer"
ORIGIN
        1 atctacgtct gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca
       61 gctctcggag ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt
      121 cctgcgggta aatagctgcg ccgatggttt ctacaaagat cgttatgttt atcggcactt
      181 tgcatcggcc gcgctcccga ttccggaagt gcttgacatt ggggaattta tgcggtgtga
      241 aataccgcac agatgcgtaa ggagaaaata ccgcatcagg cgccattcgc cattcaggct
      301 gcgcaactgt tgggaagggc gatcggtgcg ggcctcttcg ctattacgcc agctggcgaa
      361 agggggatgt gctgcaaggc gattaagttg ggtaacgcca gggttttccc agtcacgacg
      421 ttgtaaaacg acggccagtg ccaagcttgg gctgcaggtc gactctagag gatccgcggc
      481 cgcgcgcgat atcgaattcg taatcatgtc atagctgttt cctgtgtgaa attgttatcc
      541 gctcacaatt ccacacaaca tacgagccgg aagcataaag tgtaaagcct ggggtgccta
      601 atgagtgagc taactcacat taattgcgtt gcgctcactg cccgctttcc agtcgggaaa
      661 cctgtcgtgc cagctgcatt aatgaatcgg ccaacgcgcg gggagaggcg gtttgcgtat
      721 tgggcgctct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc ggctgcggcg
      781 agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag gggataacgc
      841 aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt
      901 gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc gacgctcaag
      961 tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc ctggaagctc
     1021 cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg cctttctccc
     1081 ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt cggtgtaggt
     1141 cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc gctgcgcctt
     1201 atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc cactggcagc
     1261 agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag agttcttgaa
     1321 gtggtggcct aactacggct acactagaag aacagtattt ggtatctgcg ctctgctgaa
     1381 gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg
     1441 tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga
     1501 agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact cacgttaagg
     1561 gattttggtc atgagattat caaaaaggat cttcacctag atccttttgg ttcatgtgca
     1621 gctccatcag caaaagggga tgataagttt atcaccaccg actatttgca acagtgccgt
     1681 tgatcgtgct atgatcgact gatgtcatca gcggtggagt gcaatgtcgt gcaatacgaa
     1741 tggcgaaaag ccgagctcat cggtcagctt ctcaaccttg gggttacccc cggcggtgtg
     1801 ctgctggtcc acagctcctt ccgtagcgtc cggcccctcg aagatgggcc acttggactg
     1861 atcgaggccc tgcgtgctgc gctgggtccg ggagggacgc tcgtcatgcc ctcgtggtca
     1921 ggtctggacg acgagccgtt cgatcctgcc acgtcgcccg ttacaccgga ccttggagtt
     1981 gtctctgaca cattctggcg cctgccaaat gtaaagcgca gcgcccatcc atttgccttt
     2041 gcggcagcgg ggccacaggc agagcagatc atctctgatc cattgcccct gccacctcac
     2101 tcgcctgcaa gcccggtcgc ccgtgtccat gaactcgatg ggcaggtact tctcctcggc
     2161 gtgggacacg atgccaacac gacgctgcat cttgccgagt tgatggcaaa ggttccctat
     2221 ggggtgccga gacactgcac cattcttcag gatggcaagt tggtacgcgt cgattatctc
     2281 gagaatgacc actgctgtga gcgctttgcc ttggcggaca ggtggctcaa ggagaagagc
     2341 cttcagaagg aaggtccagt cggtcatgcc tttgctcggt tgatccgctc ccgcgacatt
     2401 gtggcgacag ccctgggtca actgggccga gatccgttga tcttcctgca tccgccagag
     2461 gcgggatgcg aagaatgcga tgccgctcgc cagtcgattg gctgagctca tgagcggaga
     2521 acgagatgac gttggagggg caaggtcgcg ctgattgctg gggcaacacg tggagcggat
     2581 cggggattgt ctttcttcag ctcgctgatg atatgctgac gctcaatgcc gtttggcctc
     2641 cgactaacga aaatcccgca tttggacggc tgatccgatt ggcacggcgg acggcgaatg
     2701 gcggagcaga cgctcgtccg ggggcaatga gatatgaaaa agcctgaact caccgcgacg
     2761 tatcgatggt accatatatt taaagatcca ctagtatgca ggtcgacgga tcttttccgc
     2821 tgcataaccc tgcttcgggg tcattatagc gattttttcg gtatatccat cctttttcgc
     2881 acgatataca ggattttgcc aaagggttcg tgtagacttt ccttggtgta tccaacggcg
     2941 tcagccgggc aggataggtg aagtaggccc acccgcgagc gggtgttcct tcttcactgt
     3001 cccttattcg cacctggcgg tgctcaacgg gaatcctgct ctgcgaggct ggccggcatg
     3061 agcctgtcgg cctacctgct ggccgtcggc cagggctaca aaatcacggg cgtcgtggac
     3121 tatgagcacg tccgcgagct ggcccgcatc aatggcgacc tgggccgcct gggcggcctg
     3181 ctgaaactct ggctcaccga cgacccgcgc acggcgcggt tcggtgatgc cacgatcctc
     3241 gccctgctgg cgaagatcga agagaagcag gacgagcttg gcaaggtcat gatgggcgtg
     3301 gtccgcccga gggcagagcc atgacttttt tagccgctaa acggccgggg ggtgcgcgtg
     3361 attgccaagc acgtccccat gcgctccatc aagaagagcg acttcgcgga gctggtgaag
     3421 tacatcaccg acgagcaagg caagaccgat ccccggggac ctgcatag
//
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart