pOTENT- CMV- Flag- His- Puro Plasmid

$136.00

  • Model: PVT2340
  • 50 Units in Stock
Ask a question


Add to Cart:

pOTENT-CMV-Flag-His-Puro

Search name

pOTENT-CMV-Flag-His-Puro,Plasmid pOTENT-CMV-Flag-His-Puro,pOTENT-CMV-Flag-His-Puro vector

 

pOTENT-CMV-Flag-His-Puro Information

Promoter: CMV, T7

Replicator: M13 ori, ori, SV40 ori

Terminator: bGH poly (A) signal

Plasmid classification: virus series, lentivirus cloning vector

Plasmid size: 7509bp

Prokaryotic resistance: Kan

Screening markers: Neo

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

Use:Lentiviral

 

pOTENT-CMV-Flag-His-Puro Description

pOTENT-CMV-Flag-His-Puro-polyclonal-site

 

pOTENT-CMV-Flag-His-Puro Sequence

LOCUS       Exported                7509 bp ds-DNA     circular SYN 12-JAN-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pOTENT-CMV-Flag-His-Puro
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7509)
  AUTHORS   Huanghua
  TITLE     Direct Submission
  JOURNAL   Exported Thursday, September 8, 2016 from SnapGene Viewer 3.1.4
             
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     repeat_region   21..123
                     /note="ITR"
                     /note="inverted terminal repeat of human adenovirus 
                     serotype 5"
     misc_signal     211..361
                     /note="Ad5 Psi"
                     /note="packaging signal for adenovirus serotype 5"
     enhancer        419..722
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        723..926
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     promoter        954..972
                     /note="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             1073..1096
                     /codon_start=1
                     /product="FLAG(R) epitope tag, followed by an enterokinase 
                     cleavage site"
                     /note="FLAG"
                     /translation="DYKDDDDK"
     CDS             1106..1123
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /note="6xHis"
                     /translation="HHHHHH"
     polyA_signal    1294..1415
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     promoter        2342..2671
                     /note="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     rep_origin      2522..2657
                     /note="SV40 ori"
                     /note="SV40 origin of replication"
     CDS             2729..3328
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /note="PuroR"
                     /note="confers resistance to puromycin"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     polyA_signal    3329..3553
                     /note="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     repeat_region   4464..4566
                     /note="ITR"
                     /note="inverted terminal repeat of human adenovirus 
                     serotype 5"
     rep_origin      complement(4838..5426)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             6258..7052
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /note="NeoR/KanR"
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     rep_origin      complement(7100..7480)
                     /direction=LEFT
                     /note="M13 ori"
                     /note="M13 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
ORIGIN
        1 ttcgaattta aattaattaa catcatcaat aatatacctt attttggatt gaagccaata
       61 tgataatgag ggggtggagt ttgtgacgtg gcgcggggcg tgggaacggg gcgggtgacg
      121 tagtagtgtg gcggaagtgt gatgttgcaa gtgtggcgga acacatgtaa gcgacggatg
      181 tggcaaaagt gacgtttttg gtgtgcgccg gtgtacacag gaagtgacaa ttttcgcgcg
      241 gttttaggcg gatgttgtag taaatttggg cgtaaccgag taagatttgg ccattttcgc
      301 gggaaaactg aataagagga agtgaaatct gaataatttt gtgttactca tagcgcgtaa
      361 tactgtaata gtaatcaatt acggggtcat tagttcatag cccatatatg gagttccgcg
      421 ttacataact tacggtaaat ggcccgcctg gctgaccgcc caacgacccc cgcccattga
      481 cgtcaataat gacgtatgtt cccatagtaa cgccaatagg gactttccat tgacgtcaat
      541 gggtggagta tttacggtaa actgcccact tggcagtaca tcaagtgtat catatgccaa
     
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart