pP53- TA- luc

$215.00

  • Model: PVT10814
  • 50 Units in Stock
Ask a question


Add to Cart:

pP53-TA-luc

Catalog No. PVT10814
Packing 2ug
Function Mammal reporter plasmid
Resistance Amp
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pUC
Copy
Promoter SV40
Induction --
Forward primer
Reverse primer

 

pp53-TA-luc Information

Promoter: SV40

Replicator: pUC ori, SV40 ori

Terminator: SV40 poly (A) signal

Plasmid classification: mammalian cells, signal pathway reporting vectors.

Plasmid size: 5659bp

Prokaryotic resistance: Amp

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: primers designed according to sequence

3'sequencing primers: primers designed according to sequence

 

pp53-TA-luc Description

Pp53-TA-luc can be transfected into cells by conventional cell transfection method. The biyuntian firefly firefly firefly firefly luciferase reporter gene assay kit detection (RG005/RG006) or dual luciferase reporter gene assay kit (RG027/RG028). Ultraviolet irradiation, ion irradiation can lead to the role of DNA damage or reagent can activate p53, can be used as a positive control pp53-TA-luc report gene detection.

pp53-TA-luc-vector

 

pp53-TA-luc Sequence

LOCUS       Exported                5659 bp ds-DNA     circular SYN 04-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 2

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5659)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sunday, September 4, 2016 from SnapGene Viewer 3.1.4

             

FEATURES             Location/Qualifiers

     source          1..5659

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        96..127

                     /note="minP"

                     /note="minimal TATA-box promoter with low basal activity"

     CDS             160..1812

                     /codon_start=1

                     /product="firefly luciferase"

                     /note="luciferase"

                     /note="synthetic luc2 version of the luciferase gene"

                     /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA

                     HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP

                     ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS

                     MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA

                     RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK

                     IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY

                     GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS

                     GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL

                     LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV

                     FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV"

     polyA_signal    1856..1977

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     promoter        2171..2528

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      2379..2514

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     CDS             2559..3353

                     /codon_start=1

                     /product="aminoglycoside phosphotransferase"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     polyA_signal    3378..3426

                     /note="synthetic polyadenylation signal"

     rep_origin      complement(3753..4341)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(4541..5401)

                     /codon_start=1

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     polyA_signal    5506..5554

                     /note="synthetic polyadenylation signal"

     misc_feature    5568..5659

                     /note="pause site"

                     /note="RNA polymerase II transcriptional pause signal from 

                     the human alpha-2 globin gene"

ORIGIN

        1 ggcctaactg gccggtacca cgtttgcctt gcctggactt gcctggcctt gccttggaca

       61 tgcccgggct gtcagatctg cagaagctta gacactagag ggtatataat ggaagctcga

      121 cttccagctt ggcaatccgg tactgttggt aaagccacca tggaagatgc caaaaacatt

      181 aagaagggcc cagcgccatt ctacccactc gaagacggga ccgccggcga gcagctgcac

      241 aaagccatga agcgctacgc cctggtgccc ggcaccatcg cctttaccga cgcacatatc

      301 gaggtggaca ttacctacgc cgagtacttc gagatgagcg ttcggctggc agaagctatg

      361 aagcgctatg ggctgaatac aaaccatcgg atcgtggtgt gcagcgagaa tagcttgcag

      421 ttcttcatgc ccgtgttggg tgccctgttc atcggtgtgg ctgtggcccc agctaacgac

      481 atctacaacg agcgcgagct gctgaacagc atgggcatca gccagcccac cgtcgtattc

      541 gtgagcaaga aagggctgca aaagatcctc aacgtgcaaa agaagctacc gatcatacaa

      601 aagatcatca tcatggatag caagaccgac taccagggct tccaaagcat gtacaccttc

      661 gtgacttccc atttgccacc cggcttcaac gagtacgact tcgtgcccga gagcttcgac

      721 cgggacaaaa ccatcgccct gatcatgaac agtagtggca gtaccggatt gcccaagggc

      781 gtagccctac cgcaccgcac cgcttgtgtc cgattcagtc atgcccgcga ccccatcttc

      841 ggcaaccaga tcatccccga caccgctatc ctcagcgtgg tgccatttca ccacggcttc

      901 ggcatgttca ccacgctggg ctacttgatc tgcggctttc gggtcgtgct catgtaccgc

      961 ttcgaggagg agctattctt gcgcagcttg caagactata agattcaatc tgccctgctg

     1021 gtgcccacac tatttagctt cttcgctaag agcactctca tcgacaagta cgacctaagc

     1081 aacttgcacg agatcgccag cggcggggcg ccgctcagca aggaggtagg tgaggccgtg

     1141 gccaaacgct tccacctacc aggcatccgc cagggctacg gcctgacaga aacaaccagc

     1201 gccattctga tcacccccga aggggacgac aagcctggcg cagtaggcaa ggtggtgccc

     1261 ttcttcgagg ctaaggtggt ggacttggac accggtaaga cactgggtgt gaaccagcgc

     1321 ggcgagctgt gcgtccgtgg ccccatgatc atgagcggct acgttaacaa ccccgaggct

     1381 acaaacgctc tcatcgacaa ggacggctgg ctgcacagcg gcgacatcgc ctactgggac

     1441 gaggacgagc acttcttcat cgtggaccgg ctgaagagcc tgatcaaata caagggctac

     1501 caggtagccc cagccgaact ggagagcatc ctgctgcaac accccaacat cttcgacgcc

     1561 ggggtcgccg gcctgcccga cgacgatgcc ggcgagctgc ccgccgcagt cgtcgtgctg

     1621 gaacacggta aaaccatgac cgagaaggag atcgtggact atgtggccag ccaggttaca

     1681 accgccaaga agctgcgcgg tggtgttgtg ttcgtggacg aggtgcctaa aggactgacc

     1741 ggcaagttgg acgcccgcaa gatccgcgag attctcatta aggccaagaa gggcggcaag

     1801 atcgccgtgt aataattcta gagtcggggc ggccggccgc ttcgagcaga catgataaga

     1861 tacattgatg agtttggaca aaccacaact agaatgcagt gaaaaaaatg ctttatttgt

     1921 gaaatttgtg atgctattgc tttatttgta accattataa gctgcaataa acaagttaac

     1981 aacaacaatt gcattcattt tatgtttcag gttcaggggg aggtgtggga ggttttttaa

     2041 agcaagtaaa acctctacaa atgtggtaaa atcgataagg atccgtttgc gtattgggcg

     2101 ctcttccgct gatctgcgca gcaccatggc ctgaaataac ctctgaaaga ggaacttggt

     2161 tagctacctt ctgaggcgga aagaaccagc tgtggaatgt gtgtcagtta gggtgtggaa

     2221 agtccccagg ctccccagca ggcagaagta tgcaaagcat gcatctcaat tagtcagcaa

     2281 ccaggtgtgg aaagtcccca ggctccccag caggcagaag tatgcaaagc atgcatctca

     2341 attagtcagc aaccatagtc ccgcccctaa ctccgcccat cccgccccta actccgccca

     2401 gttccgccca ttctccgccc catggctgac taattttttt tatttatgca gaggccgagg

     2461 ccgcctctgc ctctgagcta ttccagaagt agtgaggagg cttttttgga ggcctaggct

     2521 tttgcaaaaa gctcgattct tctgacacta gcgccaccat gatcgaacaa gacggcctcc

     2581 atgctggcag tcccgcagct tgggtcgaac gcttgttcgg gtacgactgg gcccagcaga

     2641 ccatcggatg tagcgatgcg gccgtgttcc gtctaagcgc tcaaggccgg cccgtgctgt

     2701 tcgtgaagac cgacctgagc ggcgccctga acgagcttca agacgaggct gcccgcctga

     2761 gctggctggc caccaccggc gtaccctgcg ccgctgtgtt ggatgttgtg accgaagccg

     2821 gccgggactg gctgctgctg ggcgaggtcc ctggccagga tctgctgagc agccaccttg

     2881 cccccgctga gaaggtttct atcatggccg atgcaatgcg gcgcctgcac accctggacc

     2941 ccgctacctg ccccttcgac caccaggcta agcatcggat cgagcgtgct cggacccgca

     3001 tggaggccgg cctggtggac caggacgacc tggacgagga gcatcagggc ctggcccccg

     3061 ctgaactgtt cgcccgactg aaagcccgca tgccggacgg tgaggacctg gttgtcacac

     3121 acggagatgc ctgcctccct aacatcatgg tcgagaatgg ccgcttctcc ggcttcatcg

     3181 actgcggtcg cctaggagtt gccgaccgct accaggacat cgccctggcc acccgcgaca

     3241 tcgctgagga gcttggcggc gagtgggccg accgcttctt agtcttgtac ggcatcgcag

     3301 ctcccgacag ccagcgcatc gccttctacc gcttgctcga cgagttcttt taatgatcta

     3361 gaaccggtca tggccgcaat aaaatatctt tattttcatt acatctgtgt gttggttttt

     3421 tgtgtgttcg aactagatgc tgtcgaccga tgcccttgag agccttcaac ccagtcagct

     3481 ccttccggtg ggcgcggggc atgactatcg tcgccgcact tatgactgtc ttctttatca

     3541 tgcaactcgt aggacaggtg ccggcagcgc tcttccgctt cctcgctcac tgactcgctg

     3601 cgctcggtcg ttcggctgcg gcgagcggta tcagctcact caaaggcggt aatacggtta

     3661 tccacagaat caggggataa cgcaggaaag aacatgtgag caaaaggcca gcaaaaggcc

     3721 aggaaccgta aaaaggccgc gttgctggcg tttttccata ggctccgccc ccctgacgag

     3781 catcacaaaa atcgacgctc aagtcagagg tggcgaaacc cgacaggact ataaagatac

     3841 caggcgtttc cccctggaag ctccctcgtg cgctctcctg ttccgaccct gccgcttacc

     3901 ggatacctgt ccgcctttct cccttcggga agcgtggcgc tttctcatag ctcacgctgt

     3961 aggtatctca gttcggtgta ggtcgttcgc tccaagctgg gctgtgtgca cgaacccccc

     4021 gttcagcccg accgctgcgc cttatccggt aactatcgtc ttgagtccaa cccggtaaga

     4081 cacgacttat cgccactggc agcagccact ggtaacagga ttagcagagc gaggtatgta

     4141 ggcggtgcta cagagttctt gaagtggtgg cctaactacg gctacactag aagaacagta

     4201 tttggtatct gcgctctgct gaagccagtt accttcggaa aaagagttgg tagctcttga

     4261 tccggcaaac aaaccaccgc tggtagcggt ggtttttttg tttgcaagca gcagattacg

     4321 cgcagaaaaa aaggatctca agaagatcct ttgatctttt ctacggggtc tgacgctcag

     4381 tggaacgaaa actcacgtta agggattttg gtcatgagat tatcaaaaag gatcttcacc

     4441 tagatccttt taaattaaaa atgaagtttt aaatcaatct aaagtatata tgagtaaact

     4501 tggtctgaca gcggccgcaa atgctaaacc actgcagtgg ttaccagtgc ttgatcagtg

     4561 aggcaccgat ctcagcgatc tgcctatttc gttcgtccat agtggcctga ctccccgtcg

     4621 tgtagatcac tacgattcgt gagggcttac catcaggccc cagcgcagca atgatgccgc

     4681 gagagccgcg ttcaccggcc cccgatttgt cagcaatgaa ccagccagca gggagggccg

     4741 agcgaagaag tggtcctgct actttgtccg cctccatcca gtctatgagc tgctgtcgtg

     4801 atgctagagt aagaagttcg ccagtgagta gtttccgaag agttgtggcc attgctactg

     4861 gcatcgtggt atcacgctcg tcgttcggta tggcttcgtt caactctggt tcccagcggt

     4921 caagccgggt cacatgatca cccatattat gaagaaatgc agtcagctcc ttagggcctc

     4981 cgatcgttgt cagaagtaag ttggccgcgg tgttgtcgct catggtaatg gcagcactac

     5041 acaattctct taccgtcatg ccatccgtaa gatgcttttc cgtgaccggc gagtactcaa

     5101 ccaagtcgtt ttgtgagtag tgtatacggc gaccaagctg ctcttgcccg gcgtctatac

     5161 gggacaacac cgcgccacat agcagtactt tgaaagtgct catcatcggg aatcgttctt

     5221 cggggcggaa agactcaagg atcttgccgc tattgagatc cagttcgata tagcccactc

     5281 ttgcacccag ttgatcttca gcatctttta ctttcaccag cgtttcgggg tgtgcaaaaa

     5341 caggcaagca aaatgccgca aagaagggaa tgagtgcgac acgaaaatgt tggatgctca

     5401 tactcgtcct ttttcaatat tattgaagca tttatcaggg ttactagtac gtctctcaag

     5461 gataagtaag taatattaag gtacgggagg tattggacag gccgcaataa aatatcttta

     5521 ttttcattac atctgtgtgt tggttttttg tgtgaatcga tagtactaac atacgctctc

     5581 catcaaaaca aaacgaaaca aaacaaacta gcaaaatagg ctgtccccag tgcaagtgca

     5641 ggtgccagaa catttctct

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart