pPD49- 26- L754

$260.00

  • Model: PVT11326
  • 50 Units in Stock
Ask a question


Add to Cart:

pPD49-26-L754

Catalog No. PVT11326
Packing 2ug

 

pPD49-26-L754 Information

Promoter: Lac/lac

Replicon: pUC ori

Plasmid size: 3410bp

Plasmid label: IVSA, rf2128

Prokaryotic resistance: ampicillin Ampicillin

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expressing the host: nematode

Culture conditions: Reference Literature

Induction mode: Reference Literature

5'sequencing primers: M13R:CAGGAAACAGCTATGACC

3'sequencing primers: Based on full sequence design

 

pPD49-26-L754 Description

pPD49_26-L754-multiple-site

 

 

pPD49-26-L754 Sequence

LOCUS       Exported                3410 bp ds-DNA     circular SYN 04-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pPD49.26-L754

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 3410)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sunday, September 4, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..3410

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        1289..1393

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             1394..2254

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      2425..3013

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     protein_bind    3301..3322

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        3337..3367

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    3375..3391

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     3399..5

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 atgaccatga ttacgccaag cttgcatgcc tgcaggtcga ctctagagga tccccgggat

       61 tggccaaagg acccaaaggt atgtttcgaa tgatactaac ataacataga acattttcag

      121 gaggaccctt ggctagcgtc gacggtacca tggtattgat atctgagctc cgcatcggcc

      181 gctgtcatca gatcgccatc tcgcgcccgt gcctctgact tctaagtcca attactcttc

      241 aacatcccta catgctcttt ctccctgtgc tcccaccccc tatttttgtt attatcaaaa

      301 aacttctctt aatttctttg ttttttagct tcttttaagt cacctctaac aatgaaattg

      361 tgtagattca aaaatagaat taattcgtaa taaaaagtcg aaaaaaattg tgctccctcc

      421 ccccattaat aataattcta tcccaaaatc tacacaatgt tctgtgtaca cttcttatgt

      481 tttttacttc tgataaattt ttttgaaaca tcatagaaaa aaccgcacac aaaatacctt

      541 atcatatgtt acgtttcagt ttatgaccgc aatttttatt tcttcgcacg tctgggcctc

      601 tcatgacgtc aaatcatgct catcgtgaaa aagttttgga gtatttttgg aatttttcaa

      661 tcaagtgaaa gtttatgaaa ttaattttcc tgcttttgct ttttggggtt tcccctattg

      721 tttgtcaaga tttcgaggac ggcgtttttc ttgctaaaat cacaagtatt gatgagcacg

      781 atgcaagaaa gatcggaaga aggtttgggt ttgaggctca gtggaaggtg agtagaagtt

      841 gataatttga aagtggagta gtgtctatgg ggtttttgcc ttaaatgaca gaatacattc

      901 ccaatatacc aaacataact gtttcctact agtcggccgt acgggccctt tcgtctcgcg

      961 cgtttcggtg atgacggtga aaacctctga cacatgcagc tcccggagac ggtcacagct

     1021 tgtctgtaag cggatgccgg gagcagacaa gcccgtcagg gcgcgtcagc gggtgttggc

     1081 gggtgtcggg gctggcttaa ctatgcggca tcagagcaga ttgtactgag agtgcaccat

     1141 atgcggtgtg aaataccgca cagatgcgta aggagaaaat accgcatcag gcggccttaa

     1201 gggcctcgtg atacgcctat ttttataggt taatgtcatg ataataatgg tttcttagac

     1261 gtcaggtggc acttttcggg gaaatgtgcg cggaacccct atttgtttat ttttctaaat

     1321 acattcaaat atgtatccgc tcatgagaca ataaccctga taaatgcttc aataatattg

     1381 aaaaaggaag agtatgagta ttcaacattt ccgtgtcgcc cttattccct tttttgcggc

     1441 attttgcctt cctgtttttg ctcacccaga aacgctggtg aaagtaaaag atgctgaaga

     1501 tcagttgggt gcacgagtgg gttacatcga actggatctc aacagcggta agatccttga

     1561 gagttttcgc cccgaagaac gttttccaat gatgagcact tttaaagttc tgctatgtgg

     1621 cgcggtatta tcccgtattg acgccgggca agagcaactc ggtcgccgca tacactattc

     1681 tcagaatgac ttggttgagt actcaccagt cacagaaaag catcttacgg atggcatgac

     1741 agtaagagaa ttatgcagtg ctgccataac catgagtgat aacactgcgg ccaacttact

     1801 tctgacaacg atcggaggac cgaaggagct aaccgctttt ttgcacaaca tgggggatca

     1861 tgtaactcgc cttgatcgtt gggaaccgga gctgaatgaa gccataccaa acgacgagcg

     1921 tgacaccacg atgcctgtag caatggcaac aacgttgcgc aaactattaa ctggcgaact

     1981 acttactcta gcttcccggc aacaattaat agactggatg gaggcggata aagttgcagg

     2041 accacttctg cgctcggccc ttccggctgg ctggtttatt gctgataaat ctggagccgg

     2101 tgagcgtggg tctcgcggta tcattgcagc actggggcca gatggtaagc cctcccgtat

     2161 cgtagttatc tacacgacgg ggagtcaggc aactatggat gaacgaaata gacagatcgc

     2221 tgagataggt gcctcactga ttaagcattg gtaactgtca gaccaagttt actcatatat

     2281 actttagatt gatttaaaac ttcattttta atttaaaagg atctaggtga agatcctttt

     2341 tgataatctc atgaccaaaa tcccttaacg tgagttttcg ttccactgag cgtcagaccc

     2401 cgtagaaaag atcaaaggat cttcttgaga tccttttttt ctgcgcgtaa tctgctgctt

     2461 gcaaacaaaa aaaccaccgc taccagcggt ggtttgtttg ccggatcaag agctaccaac

     2521 tctttttccg aaggtaactg gcttcagcag agcgcagata ccaaatactg tccttctagt

     2581 gtagccgtag ttaggccacc acttcaagaa ctctgtagca ccgcctacat acctcgctct

     2641 gctaatcctg ttaccagtgg ctgctgccag tggcgataag tcgtgtctta ccgggttgga

     2701 ctcaagacga tagttaccgg ataaggcgca gcggtcgggc tgaacggggg gttcgtgcac

     2761 acagcccagc ttggagcgaa cgacctacac cgaactgaga tacctacagc gtgagcattg

     2821 agaaagcgcc acgcttcccg aagggagaaa ggcggacagg tatccggtaa gcggcagggt

     2881 cggaacagga gagcgcacga gggagcttcc agggggaaac gcctggtatc tttatagtcc

     2941 tgtcgggttt cgccacctct gacttgagcg tcgatttttg tgatgctcgt caggggggcg

     3001 gagcctatgg aaaaacgcca gcaacgcggc ctttttacgg ttcctggcct tttgctggcc

     3061 ttttgctcac atgttctttc ctgcgttatc ccctgattct gtggataacc gtattaccgc

     3121 ctttgagtga gctgataccg ctcgccgcag ccgaacgacc gagcgcagcg agtcagtgag

     3181 cgaggaagcg gaagagcgcc caatacgcaa accgcctctc cccgcgcgtt ggccgattca

     3241 ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg ggcagtgagc gcaacgcaat

     3301 taatgtgagt tagctcactc attaggcacc ccaggcttta cactttatgc ttccggctcg

     3361 tatgttgtgt ggaattgtga gcggataaca atttcacaca ggaaacagct

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart