pPD95_67

$215.00

  • Model: PVT11324
  • 50 Units in Stock
Ask a question


Add to Cart:

pPD95_67


Catalog No. PVT11324
Packing 2ug

 

pPD95_67 Information

Replicon: pUC ori

Plasmid Classification: Nematode Expression Plasmids

Plasmid size: 4532 BP

Plasmid labels: IVSA, SV40NLS, gfpN, IVSR, gfpS65C, IVSS, IVST, gfpC, IVSL, decoy

Prokaryotic resistance: Ampicillin

Cloning strain: DH5alpha

Culture conditions: 37 C, aerobic, LB

Expression host: nematode

Culture Conditions: Reference to Related Literature

Induction: Reference to relevant literature

5'Sequencing Primer: M13R: CAGGAAACAGCTATGACC

3'Sequencing Primers: Design Based on Full Sequence

 

pPD95_67 Site

pPD95_67-plasmid

pPD95_67 Sequence

LOCUS       Exported                4532 bp ds-DNA     circular SYN 04-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pPD95_67

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4532)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sunday, September 4, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..4532

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             146..166

                     /codon_start=1

                     /product="nuclear localization signal of SV40 large T 

                     antigen"

                     /note="SV40 NLS"

                     /translation="PKKKRKV"

     misc_feature    167..580

                     /note="GFP"

     promoter        2277..2381

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             2382..3242

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      3413..4001

                     /direction=RIGHT

                     /note="pUC ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     protein_bind    4289..4310

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        4325..4355

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    4363..4379

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     4387..4403

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

ORIGIN

        1 aagcttgcat gcctgcaggt cgactctaga ggatccccgg gattggccaa aggacccaaa

       61 ggtatgtttc gaatgatact aacataacat agaacatttt caggaggacc cttggagggt

      121 accgagctca gaaaaaatga ctgctccaaa gaagaagcgt aaggtaccgg tagaaaaaat

      181 gagtaaagga gaagaacttt tcactggagt tgtcccaatt cttgttgaat tagatggtga

      241 tgttaatggg cacaaatttt ctgtcagtgg agagggtgaa ggtgatgcaa catacggaaa

      301 acttaccctt aaatttattt gcactactgg aaaactacct gttccatggg taagtttaaa

      361 catatatata ctaactaacc ctgattattt aaattttcag ccaacacttg tcactacttt

      421 ctgttatggt gttcaatgct tctcgagata cccagatcat atgaaacggc atgacttttt

      481 caagagtgcc atgcccgaag gttatgtaca ggaaagaact atatttttca aagatgacgg

      541 gaactacaag acacgtaagt ttaaacagtt cggtactaac taaccataca tatttaaatt

      601 ttcaggtgct gaagtcaagt ttgaaggtga tacccttgtt aatagaatcg agttaaaagg

      661 tattgatttt aaagaagatg gaaacattct tggacacaaa ttggaataca actataactc

      721 acacaatgta tacatcatgg cagacaaaca aaagaatgga atcaaagttg taagtttaaa

      781 catgatttta ctaactaact aatctgattt aaattttcag aacttcaaaa ttagacacaa

      841 cattgaagat ggaagcgttc aactagcaga ccattatcaa caaaatactc caattggcga

      901 tggccctgtc cttttaccag acaaccatta cctgtccaca caatctgccc tttcgaaaga

      961 tcccaacgaa aagagagacc acatggtcct tcttgagttt gtaacagctg ctgggattac

     1021 acatggcatg gatgaactat acaaatagca ttcgtagaat tccaactgag cgccggtcgc

     1081 taccattacc aacttgtctg gtgtcaaaaa taataggggc cgctgtcatc agagtaagtt

     1141 taaactgagt tctactaact aacgagtaat atttaaattt tcagcatctc gcgcccgtgc

     1201 ctctgacttc taagtccaat tactcttcaa catccctaca tgctctttct ccctgtgctc

     1261 ccacccccta tttttgttat tatcaaaaaa cttctcttaa tttctttgtt ttttagcttc

     1321 ttttaagtca cctctaacaa tgaaattgtg tagattcaaa aatagaatta attcgtaata

     1381 aaaagtcgaa aaaaattgtg ctccctcccc ccattaataa taattctatc ccaaaatcta

     1441 cacaatgttc tgtgtacact tcttatgttt tttacttctg ataaattttt ttgaaacatc

     1501 atagaaaaaa ccgcacacaa aataccttat catatgttac gtttcagttt atgaccgcaa

     1561 tttttatttc ttcgcacgtc tgggcctctc atgacgtcaa atcatgctca tcgtgaaaaa

     1621 gttttggagt atttttggaa tttttcaatc aagtgaaagt ttatgaaatt aattttcctg

     1681 cttttgcttt ttggggtttc ccctattgtt tgtcaagatt tcgaggacgg cgtttttctt

     1741 gctaaaatca caagtattga tgagcacgat gcaagaaaga tcggaagaag gtttgggttt

     1801 gaggctcagt ggaaggtgag tagaagttga taatttgaaa gtggagtagt gtctatgggg

     1861 tttttgcctt aaatgacaga atacattccc aatataccaa acataactgt ttcctactag

     1921 tcggccgtac gggccctttc gtctcgcgcg tttcggtgat gacggtgaaa acctctgaca

     1981 catgcagctc ccggagacgg tcacagcttg tctgtaagcg gatgccggga gcagacaagc

     2041 ccgtcagggc gcgtcagcgg gtgttggcgg gtgtcggggc tggcttaact atgcggcatc

     2101 agagcagatt gtactgagag tgcaccatat gcggtgtgaa ataccgcaca gatgcgtaag

     2161 gagaaaatac cgcatcaggc ggccttaagg gcctcgtgat acgcctattt ttataggtta

     2221 atgtcatgat aataatggtt tcttagacgt caggtggcac ttttcgggga aatgtgcgcg

     2281 gaacccctat ttgtttattt ttctaaatac attcaaatat gtatccgctc atgagacaat

     2341 aaccctgata aatgcttcaa taatattgaa aaaggaagag tatgagtatt caacatttcc

     2401 gtgtcgccct tattcccttt tttgcggcat tttgccttcc tgtttttgct cacccagaaa

     2461 cgctggtgaa agtaaaagat gctgaagatc agttgggtgc acgagtgggt tacatcgaac

     2521 tggatctcaa cagcggtaag atccttgaga gttttcgccc cgaagaacgt tttccaatga

     2581 tgagcacttt taaagttctg ctatgtggcg cggtattatc ccgtattgac gccgggcaag

     2641 agcaactcgg tcgccgcata cactattctc agaatgactt ggttgagtac tcaccagtca

     2701 cagaaaagca tcttacggat ggcatgacag taagagaatt atgcagtgct gccataacca

     2761 tgagtgataa cactgcggcc aacttacttc tgacaacgat cggaggaccg aaggagctaa

     2821 ccgctttttt gcacaacatg ggggatcatg taactcgcct tgatcgttgg gaaccggagc

     2881 tgaatgaagc cataccaaac gacgagcgtg acaccacgat gcctgtagca atggcaacaa

     2941 cgttgcgcaa actattaact ggcgaactac ttactctagc ttcccggcaa caattaatag

     3001 actggatgga ggcggataaa gttgcaggac cacttctgcg ctcggccctt ccggctggct

     3061 ggtttattgc tgataaatct ggagccggtg agcgtgggtc tcgcggtatc attgcagcac

     3121 tggggccaga tggtaagccc tcccgtatcg tagttatcta cacgacgggg agtcaggcaa

     3181 ctatggatga acgaaataga cagatcgctg agataggtgc ctcactgatt aagcattggt

     3241 aactgtcaga ccaagtttac tcatatatac tttagattga tttaaaactt catttttaat

     3301 ttaaaaggat ctaggtgaag atcctttttg ataatctcat gaccaaaatc ccttaacgtg

     3361 agttttcgtt ccactgagcg tcagaccccg tagaaaagat caaaggatct tcttgagatc

     3421 ctttttttct gcgcgtaatc tgctgcttgc aaacaaaaaa accaccgcta ccagcggtgg

     3481 tttgtttgcc ggatcaagag ctaccaactc tttttccgaa ggtaactggc ttcagcagag

     3541 cgcagatacc aaatactgtc cttctagtgt agccgtagtt aggccaccac ttcaagaact

     3601 ctgtagcacc gcctacatac ctcgctctgc taatcctgtt accagtggct gctgccagtg

     3661 gcgataagtc gtgtcttacc gggttggact caagacgata gttaccggat aaggcgcagc

     3721 ggtcgggctg aacggggggt tcgtgcacac agcccagctt ggagcgaacg acctacaccg

     3781 aactgagata cctacagcgt gagcattgag aaagcgccac gcttcccgaa gggagaaagg

     3841 cggacaggta tccggtaagc ggcagggtcg gaacaggaga gcgcacgagg gagcttccag

     3901 ggggaaacgc ctggtatctt tatagtcctg tcgggtttcg ccacctctga cttgagcgtc

     3961 gatttttgtg atgctcgtca ggggggcgga gcctatggaa aaacgccagc aacgcggcct

     4021 ttttacggtt cctggccttt tgctggcctt ttgctcacat gttctttcct gcgttatccc

     4081 ctgattctgt ggataaccgt attaccgcct ttgagtgagc tgataccgct cgccgcagcc

     4141 gaacgaccga gcgcagcgag tcagtgagcg aggaagcgga agagcgccca atacgcaaac

     4201 cgcctctccc cgcgcgttgg ccgattcatt aatgcagctg gcacgacagg tttcccgact

     4261 ggaaagcggg cagtgagcgc aacgcaatta atgtgagtta gctcactcat taggcacccc

     4321 aggctttaca ctttatgctt ccggctcgta tgttgtgtgg aattgtgagc ggataacaat

     4381 ttcacacagg aaacagctat gaccatgatt acgccaagct gtaagtttaa acatgatctt

     4441 actaactaac tattctcatt taaattttca gagcttaaaa atggctgaaa tcactcacaa

     4501 cgatggatac gctaacaact tggaaatgaa at

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart