pQE- 10 Plasmid

$216.00

  • Model: PVT0508
  • 50 Units in Stock
Ask a question


Add to Cart:

pQE-10

Search name

pQE-10,Plasmid pQE-10,pQE-10 vector

 

pQE-10 Multiple cloning site

pQE-10-vector

pQE-10 Sequence

LOCUS       Exported                3442 bp ds-DNA     circular SYN 03-DEC-2013
DEFINITION  Bacterial vector for expressing N-terminally 6xHis-tagged proteins.
            For other reading frames, use pQE-9 or pQE-11.
ACCESSION   .
VERSION     .
KEYWORDS    pQE-10
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3442)
  AUTHORS   Qiagen
  TITLE     Direct Submission
  JOURNAL   Exported Wednesday, September 14, 2016 from SnapGene Viewer 3.1.4
COMMENT     Discontinued pQE vector.
FEATURES             Location/Qualifiers
     source          1..3442
                     /organism="synthetic DNA construct"
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
     promoter        10..54
                     /note="T5 promoter"
                     /note="bacteriophage T5 promoter for E. coli RNA
                     polymerase, with embedded lac operator"
     protein_bind    30..46
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     protein_bind    62..78
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     RBS             101..106
                     /note="ribosome binding site"
     CDS             115..117
                     /codon_start=1
                     /product="start codon"
                     /note="ATG"
                     /translation="M"
     CDS             127..144
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /note="6xHis"
                     /translation="HHHHHH"
     misc_feature    147..172
                     /note="MCS"
                     /note="multiple cloning site"
     misc_feature    172..182
                     /note="stop codons"
                     /note="stop codons in all three reading frames"
     terminator      188..282
                     /note="lambda t0 terminator"
                     /note="transcription terminator from phage lambda"
     CDS             326..985
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     terminator      1050..1136
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     rep_origin      complement(1618..2206)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(2377..3237)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQAAMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(3238..3342)
                     /gene="bla"
                     /note="AmpR promoter"
ORIGIN
        1 ctcgagaaat cataaaaaat ttatttgctt tgtgagcgga taacaattat aatagattca
       61 attgtgagcg gataacaatt tcacacagaa ttcattaaag aggagaaatt aactatgaga
      121 ggatctcacc atcaccatca ccatacggat ccgtcgacct gcagccaagc ttaattagct
      181 gagcttggac tcctgttgat agatccagta atgacctcag aactccatct ggatttgttc
      241 agaacgctcg gttgccgccg ggcgtttttt attggtgaga atccaagcta gcttggcgag
      301 attttcagga gctaaggaag ctaaaatgga gaaaaaaatc actggatata ccaccgttga
      361 tatatcccaa tggcatcgta aagaacattt tgaggcattt cagtcagttg ctcaatgtac
      421 ctataaccag accgttcagc tggatattac ggccttttta aagaccgtaa agaaaaataa
      481 gcacaagttt tatccggcct ttattcacat tcttgcccgc ctgatgaatg ctcatccgga
      541 atttcgtatg gcaatgaaag acggtgagct ggtgatatgg gatagtgttc acccttgtta
      601 caccgttttc catgagcaaa ctgaaacgtt ttcatcgctc tggagtgaat accacgacga
      661 tttccggcag tttctacaca tatattcgca agatgtggcg tgttacggtg aaaacctggc
      721 ctatttccct aaagggttta ttgagaatat gtttttcgtc tcagccaatc cctgggtgag
      781 tttcaccagt tttgatttaa acgtggccaa tatggacaac ttcttcgccc ccgttttcac
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart