pRE112 Plasmid

$216.00

  • Model: PVT6020
  • 50 Units in Stock
Ask a question


Add to Cart:

pRE112 Plasmid

Search name

pRE112/X7213,Plasmid pRE112/X7213,pRE112/X7213 vector

 

pRE112 Information

Prokaryotic resistance: chloramphenicol Chl

Screening markers: SacB

Cloned strain: Escherichia coli SM10 lambda PIR

Culture conditions: 37 degrees centigrade

Use:Homologous recombination HR plasmid

 

pRE112 Description

PRE112 is a SacB suicide plasmid of Escherichia coli

 

pRE112 Sequence

LOCUS       Exported                5760 bp ds-DNA     circular SYN 21-DEC-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..5760
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      93..482
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K; 
                     requires the R6K initiator protein pi for replication"
     promoter        510..955
                     /gene="sacR"
                     /label=sacB promoter
                     /note="sacB promoter and control region"
     CDS             956..2377
                     /codon_start=1
                     /gene="Bacillus subtilis sacB"
                     /product="secreted levansucrase that renders bacterial 
                     growth sensitive to sucrose"
                     /label=SacB
                     /note="negative selection marker"
                     /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH
                     ITRHDMLQIPEQQKNEKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH
                     IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW
                     SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG
                     KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA
                     YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE
                     IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK
                     MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV
                     VKDSILEQGQLTVNK"
     CDS             complement(3216..3875)
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=Chl
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(3876..3978)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     oriT            4707..4816
                     /note="incP origin of transfer"
     CDS             4849..5220
                     /codon_start=1
                     /gene="traJ"
                     /product="oriT-recognizing protein"
                     /label=traJ
                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV
                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE
                     KQDELGKVMMGVVRPRAEP"
ORIGIN
        1 cgcgtttccg agaaccgcgc gaacgacatg gagcggcacg cgggcgtgga aagcctggtc
       61 ggctggatcg gcacgatgcg tccggcgtag aggatctgaa gatccagcag ttcaacctgt
      121 tgatagtacg tactaagctc tcatgtttca cgtactaagc tctcatgttt aacgtactaa
      181 gctctcatgt ttaacgaact aaaccctcat ggctaacgta ctaagctctc atggctaacg
      241 tactaagctc tcatgtttca cgtactaagc tctcatgttt gaacaataaa attaatataa
      301 atcagcaact taaatagcct ctaaggtttt aagttttata agaaaaaaaa gaatatataa
      361 ggcttttaaa gcttttaagg tttaacggtt gtggacaaca agccagggat gtaacgcact
      421 gagaagccct tagagcctct caaagcaatt ttcagtgaca caggaacact taacggctga
      481 catgggaatt ctgatccttt ttaacccatc acatatacct gccgttcact attatttagt
      541 gaaatgagat attatgatat tttctgaatt gtgattaaaa aggcaacttt atgcccatgc
      601 aacagaaact ataaaaaata cagagaatga aaagaaacag atagattttt tagttcttta
      661 ggcccgtagt ctgcaaatcc ttttatgatt ttctatcaaa caaaagagga aaatagacca
      721 gttgcaatcc aaacgagagt ctaatagaat gaggtcgaaa agtaaatcgc gcgggtttgt
      781 tactgataaa gcaggcaaga cctaaaatgt gtaaagggca aagtgtatac tttggcgtca
      841 ccccttacat attttaggtc tttttttatt gtgcgtaact aacttgccat cttcaaacag
      901 gagggctgga agaagcagac cgctaacaca gtacataaaa aaggagacat gaacgatgaa
      961 catcaaaaag tttgcaaaac aagcaacagt attaaccttt actaccgcac tgctggcagg
     1021 aggcgcaact caagcgtttg cgaaagaaac gaaccaaaag ccatataagg aaacatacgg
     1081 catttcccat attacacgcc atgatatgct gcaaatccct gaacagcaaa aaaatgaaaa
     1141 atatcaagtt cctgagttcg attcgtccac aattaaaaat atctcttctg caaaaggcct
     1201 ggacgtttgg gacagctggc cattacaaaa cgctgacggc actgtcgcaa actatcacgg
     1261 ctaccacatc gtctttgcat tagccggaga tcctaaaaat gcggatgaca catcgattta
     1321 catgttctat caaaaagtcg gcgaaacttc tattgacagc tggaaaaacg ctggccgcgt
     1381 ctttaaagac agcgacaaat tcgatgcaaa tgattctatc ctaaaagacc aaacacaaga
     1441 atggtcaggt tcagccacat ttacatctga cggaaaaatc cgtttattct acactgattt
     1501 ctccggtaaa cattacggca aacaaacact gacaactgca caagttaacg tatcagcatc
     1561 agacagctct ttgaacatca acggtgtaga ggattataaa tcaatctttg acggtgacgg
     1621 aaaaacgtat caaaatgtac agcagttcat cgatgaaggc aactacagct caggcgacaa
     1681 ccatacgctg agagatcctc actacgtaga agataaaggc cacaaatact tagtatttga
     1741 agcaaacact ggaactgaag atggctacca aggcgaagaa tctttattta acaaagcata
     1801 ctatggcaaa agcacatcat tcttccgtca agaaagtcaa aaacttctgc aaagcgataa
     1861 aaaacgcacg gctgagttag caaacggcgc tctcggtatg attgagctaa acgatgatta
     1921 cacactgaaa aaagtgatga aaccgctgat tgcatctaac acagtaacag atgaaattga
     1981 acgcgcgaac gtctttaaaa tgaacggcaa atggtatctg ttcactgact cccgcggatc
     2041 aaaaatgacg attgacggca ttacgtctaa cgatatttac atgcttggtt atgtttctaa
     2101 ttctttaact ggcccataca agccgctgaa caaaactggc cttgtgttaa aaatggatct
     2161 tgatcctaac gatgtaacct ttacttactc acacttcgct gtacctcaag cgaaaggaaa
     2221 caatgtcgtg attacaagct atatgacaaa cagaggattc tacgcagaca aacaatcaac
     2281 gtttgcgccc agcttcctgc tgaacatcaa aggcaagaaa acatctgttg tcaaagacag
     2341 catccttgaa caaggacaat taacagttaa caaataaaaa cgcaaaagaa aatgccgata
     2401 tcctattggc attttctttt atttcttatc aacataaagg tgaatcccat atgaactata
     2461 taaaagcagg caaatggcta accgtattcc taaccttttg gtaatgactc caacttattg
     2521 atagtgtttt atgttcagat aatgcccgat gactttgtca tgcagctcca ccgattttga
     2581 gaacgacagc gacttccgtc ccagccgtgc caggtgctgc ctcagattca ggttatgccg
     2641 ctcaattcgc tgcgtatatc gcttgctgat tacgtgcagc tttcccttca ggcgggattc
     2701 atacagcggc cagccatccg tcatccatat caccacgtca aagggtgaca gcaggctcat
     2761 aagacgcccc agcgtcgcca tagtgcgttc accgaatacg tgcgcaacaa ccgtcttccg
     2821 gagactgtca tacgcgtaaa acagccagcg ctggcgcgat ttagccccga catagcccca
     2881 ctgttcgtcc atttccgcgc agacgatgac gtcactgccc ggctgtatgc gcgaggttac
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart