pRE112 Plasmid

$216.00

  • Model: PVT6020
  • 50 Units in Stock
Ask a question


Add to Cart:

pRE112 Plasmid

PVT6020     2ug

 

pRE112 Plasmid Information

Prokaryotic resistance: chloramphenicol Chl

Screening markers: SacB

Cloned strain: Escherichia coli SM10 lambda PIR

Culture conditions: 37 degrees centigrade

Use:Homologous recombination HR plasmid

 

pRE112 Plasmid Description

pRE112 Plasmid is a SacB suicide plasmid of Escherichia coli

 

pRE112 Plasmid Sequence

LOCUS       Exported                5760 bp ds-DNA     circular SYN 21-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..5760

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      93..482

                     /label=R6K gamma ori

                     /note="gamma replication origin from E. coli plasmid R6K; 

                     requires the R6K initiator protein pi for replication"

     promoter        510..955

                     /gene="sacR"

                     /label=sacB promoter

                     /note="sacB promoter and control region"

     CDS             956..2377

                     /codon_start=1

                     /gene="Bacillus subtilis sacB"

                     /product="secreted levansucrase that renders bacterial 

                     growth sensitive to sucrose"

                     /label=SacB

                     /note="negative selection marker"

                     /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH

                     ITRHDMLQIPEQQKNEKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH

                     IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW

                     SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG

                     KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA

                     YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE

                     IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK

                     MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV

                     VKDSILEQGQLTVNK"

     CDS             complement(3216..3875)

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=Chl

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     promoter        complement(3876..3978)

                     /label=cat promoter

                     /note="promoter of the E. coli cat gene encoding 

                     chloramphenicol acetyltransferase"

     oriT            4707..4816

                     /note="incP origin of transfer"

     CDS             4849..5220

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

ORIGIN

        1 cgcgtttccg agaaccgcgc gaacgacatg gagcggcacg cgggcgtgga aagcctggtc

       61 ggctggatcg gcacgatgcg tccggcgtag aggatctgaa gatccagcag ttcaacctgt

      121 tgatagtacg tactaagctc tcatgtttca cgtactaagc tctcatgttt aacgtactaa

      181 gctctcatgt ttaacgaact aaaccctcat ggctaacgta ctaagctctc atggctaacg

      241 tactaagctc tcatgtttca cgtactaagc tctcatgttt gaacaataaa attaatataa

      301 atcagcaact taaatagcct ctaaggtttt aagttttata agaaaaaaaa gaatatataa

      361 ggcttttaaa gcttttaagg tttaacggtt gtggacaaca agccagggat gtaacgcact

      421 gagaagccct tagagcctct caaagcaatt ttcagtgaca caggaacact taacggctga

      481 catgggaatt ctgatccttt ttaacccatc acatatacct gccgttcact attatttagt

      541 gaaatgagat attatgatat tttctgaatt gtgattaaaa aggcaacttt atgcccatgc

      601 aacagaaact ataaaaaata cagagaatga aaagaaacag atagattttt tagttcttta

      661 ggcccgtagt ctgcaaatcc ttttatgatt ttctatcaaa caaaagagga aaatagacca

      721 gttgcaatcc aaacgagagt ctaatagaat gaggtcgaaa agtaaatcgc gcgggtttgt

      781 tactgataaa gcaggcaaga cctaaaatgt gtaaagggca aagtgtatac tttggcgtca

      841 ccccttacat attttaggtc tttttttatt gtgcgtaact aacttgccat cttcaaacag

      901 gagggctgga agaagcagac cgctaacaca gtacataaaa aaggagacat gaacgatgaa

      961 catcaaaaag tttgcaaaac aagcaacagt attaaccttt actaccgcac tgctggcagg

     1021 aggcgcaact caagcgtttg cgaaagaaac gaaccaaaag ccatataagg aaacatacgg

     1081 catttcccat attacacgcc atgatatgct gcaaatccct gaacagcaaa aaaatgaaaa

     1141 atatcaagtt cctgagttcg attcgtccac aattaaaaat atctcttctg caaaaggcct

     1201 ggacgtttgg gacagctggc cattacaaaa cgctgacggc actgtcgcaa actatcacgg

     1261 ctaccacatc gtctttgcat tagccggaga tcctaaaaat gcggatgaca catcgattta

     1321 catgttctat caaaaagtcg gcgaaacttc tattgacagc tggaaaaacg ctggccgcgt

     1381 ctttaaagac agcgacaaat tcgatgcaaa tgattctatc ctaaaagacc aaacacaaga

     1441 atggtcaggt tcagccacat ttacatctga cggaaaaatc cgtttattct acactgattt

     1501 ctccggtaaa cattacggca aacaaacact gacaactgca caagttaacg tatcagcatc

     1561 agacagctct ttgaacatca acggtgtaga ggattataaa tcaatctttg acggtgacgg

     1621 aaaaacgtat caaaatgtac agcagttcat cgatgaaggc aactacagct caggcgacaa

     1681 ccatacgctg agagatcctc actacgtaga agataaaggc cacaaatact tagtatttga

     1741 agcaaacact ggaactgaag atggctacca aggcgaagaa tctttattta acaaagcata

     1801 ctatggcaaa agcacatcat tcttccgtca agaaagtcaa aaacttctgc aaagcgataa

     1861 aaaacgcacg gctgagttag caaacggcgc tctcggtatg attgagctaa acgatgatta

     1921 cacactgaaa aaagtgatga aaccgctgat tgcatctaac acagtaacag atgaaattga

     1981 acgcgcgaac gtctttaaaa tgaacggcaa atggtatctg ttcactgact cccgcggatc

     2041 aaaaatgacg attgacggca ttacgtctaa cgatatttac atgcttggtt atgtttctaa

     2101 ttctttaact ggcccataca agccgctgaa caaaactggc cttgtgttaa aaatggatct

     2161 tgatcctaac gatgtaacct ttacttactc acacttcgct gtacctcaag cgaaaggaaa

     2221 caatgtcgtg attacaagct atatgacaaa cagaggattc tacgcagaca aacaatcaac

     2281 gtttgcgccc agcttcctgc tgaacatcaa aggcaagaaa acatctgttg tcaaagacag

     2341 catccttgaa caaggacaat taacagttaa caaataaaaa cgcaaaagaa aatgccgata

     2401 tcctattggc attttctttt atttcttatc aacataaagg tgaatcccat atgaactata

     2461 taaaagcagg caaatggcta accgtattcc taaccttttg gtaatgactc caacttattg

     2521 atagtgtttt atgttcagat aatgcccgat gactttgtca tgcagctcca ccgattttga

     2581 gaacgacagc gacttccgtc ccagccgtgc caggtgctgc ctcagattca ggttatgccg

     2641 ctcaattcgc tgcgtatatc gcttgctgat tacgtgcagc tttcccttca ggcgggattc

     2701 atacagcggc cagccatccg tcatccatat caccacgtca aagggtgaca gcaggctcat

     2761 aagacgcccc agcgtcgcca tagtgcgttc accgaatacg tgcgcaacaa ccgtcttccg

     2821 gagactgtca tacgcgtaaa acagccagcg ctggcgcgat ttagccccga catagcccca

     2881 ctgttcgtcc atttccgcgc agacgatgac gtcactgccc ggctgtatgc gcgaggttac

     2941 cgactgcggc ctgagttttt taagtgacgt aaaatcgtgt tgaggccaac gcccataatg

     3001 cgggctgttg cccggcatcc aacgccattc atggccatat caatgatttt ctggtgcgta

     3061 ccgggttgag aagcggtgta agtgaactgc atgaattccc gggagagctc gatatcgcat

     3121 gcggtacctc tagaagaagc ttgggatcgg gccctatcac ttattcaggc gtagcaacca

     3181 ggcgtttaag ggcaccaata actgccttaa aaaaattacg ccccgccctg ccactcatcg

     3241 cagtactgtt gtaattcatt aagcattctg ccgacatgga agccatcaca gacggcatga

     3301 tgaacctgaa tcgccagcgg catcagcacc ttgtcgcctt gcgtataata tttgcccatg

     3361 gtgaaaacgg gggcgaagaa gttgtccata ttggccacgt ttaaatcaaa actggtgaaa

     3421 ctcacccagg gattggctga gacgaaaaac atattctcaa taaacccttt agggaaatag

     3481 gccaggtttt caccgtaaca cgccacatct tgcgaatata tgtgtagaaa ctgccggaaa

     3541 tcgtcgtggt attcactcca gagcgatgaa aacgtttcag tttgctcatg gaaaacggtg

     3601 taacaagggt gaacactatc ccatatcacc agctcaccgt ctttcattgc catacggaat

     3661 tccggatgag cattcatcag gcgggcaaga atgtgaataa aggccggata aaacttgtgc

     3721 ttatttttct ttacggtctt taaaaaggcc gtaatatcca gctgaacggt ctggttatag

     3781 gtacattgag caactgactg aaatgcctca aaatgttctt tacgatgcca ttgggatata

     3841 tcaacggtgg tatatccagt gatttttttc tccattttag cttccttagc tcctgaaaat

     3901 ctcgataact caaaaaatac gcccggtagt gatcttattt cattatggtg aaagttggaa

     3961 cctcttacgt gccgatcaac gtctcatttt cgccaaaagt tggcccaggg cttcccggta

     4021 tcaacaggga caccaggatt tatttattct gcgaagtgat cttccgtcac aggtattagg

     4081 gcccgatcct ttttgtccgg tgttgggttg aaggtgaagc cggtcggggc cgcagcgggg

     4141 gccggctttt cagccttgcc cccctgcttc ggccgccgtg gctccggcgt cttgggtgcc

     4201 ggcgcgggtt ccgcagcctt ggcctgcggt gcgggcacat cggcgggctt ggccttgatg

     4261 tgccgcctgg cgtgcgagcg gaacgtctcg taggagaact tgaccttccc cgtttcccgc

     4321 atgtgctccc aaatggtgac gagcgcatag ccggacgcta acgccgcctc gacatccgcc

     4381 ctcaccgcca ggaacgcaac cgcagcctca tcacgccggc gcttcttggc cgcgcgggat

     4441 tcaacccact cggccagctc gtcggtgtag ctctttggca tcgtctctcg cctgtcccct

     4501 cagttcagta atttcctgca tttgcctgtt tccagtcggt agatattcca caaaacagca

     4561 gggaagcagc gcttttccgc tgcataaccc tgcttcgggg tcattatagc gattttttcg

     4621 gtatatccat cctttttcgc acgatataca ggattttgcc aaagggttcg tgtagacttt

     4681 ccttggtgta tccaacggcg tcagccgggc aggataggtg aagtaggccc acccgcgagc

     4741 gggtgttcct tcttcactgt cccttattcg cacctggcgg tgctcaacgg gaatcctgct

     4801 ctgcgaggct ggccggctac cgccggcgta acagatgagg gcaagcggat ggctgatgaa

     4861 accaagccaa ccaggaaggg cagcccacct atcaaggtgt actgccttcc agacgaacga

     4921 agagcgattg aggaaaaggc ggcggcggcc ggcatgagcc tgtcggccta cctgctggcc

     4981 gtcggccagg gctacaaaat cacgggcgtc gtggactatg agcacgtccg cgagctggcc

     5041 cgcatcaatg gcgacctggg ccgcctgggc ggcctgctga aactctggct caccgacgac

     5101 ccgcgcacgg cgcggttcgg tgatgccacg atcctcgccc tgctggcgaa gatcgaagag

     5161 aagcaggacg agcttggcaa ggtcatgatg ggcgtggtcc gcccgagggc agagccatga

     5221 cttttttagc cgctaaaacg gccggggggt gcgcgtgatt gccaagcacg tccccatgcg

     5281 ctccatcaag aagagcgact tcgcggagct ggtgaagtac atcaccgacg agcaaggcaa

     5341 gaccgagcgc ctgggtcacg tgcgcgtcac gaactgcgag gcaaacaccc tgcccgctgt

     5401 catggccgag gtgatggcga cccagcacgg caacacccgt tccgaggccg acaagaccta

     5461 tcacctgctg gttagcttcc gcgcgggaga gaagcccgac gcggagacgt tgcgcgcgat

     5521 tgaggaccgc atctgcgctg ggcttggctt cgccgagcat cagcgcgtca gtgccgtgca

     5581 tcacgacacc gacaacctgc acatccatat cgccatcaac aagattcacc cgacccgaaa

     5641 caccatccat gagccgtatc gggcctaccg cgccctcgct gacctctgcg cgacgctcga

     5701 acgggactac gggcttgagc gtgacaatca cgaaacgcgg cagcgcgttt ccgagaaccg

//

 

Caution:
Product is for research use only!

 

Search name

pRE112/X7213,Plasmid pRE112/X7213,pRE112/X7213 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart