pRevTRE

$136.00

  • Model: PVT1406
  • 50 Units in Stock
Ask a question


Add to Cart:

pRevTRE

PVT1406      2ug
 

 

pRevTRE Information

Promoter: CMV

Replicon: pUC ori

Plasmid classification: mammalian cells, tetracycline system vector.

Plasmid size: 6487bp

Prokaryotic resistance: Amp

Screening markers: Hyg

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Inducement: tetracycline induction

5'sequencing primers: primers designed according to sequence

3'sequencing primers: primers designed according to sequence

 

pRevTRE Description

pRevTRE is a retroviral Tet response vector that expresses a gene of interest from the Tetresponse element (TRE). This vector is derived from pLNCX, a retroviral vector created using elements of Moloney murine leukemia virus (MoMuLV) and Moloney murine sarcoma virus (MoMuSV) as described (1). The TRE contains seven direct repeats of the tetO operator sequence, upstream of a minimal CMV promoter, which can be bound by the tTA and rtTA transactivators. The 5' viral LTR controls expression of the transcript that contains Ψ+ (the extended viral packaging signal) and the hygromycin resistance (Hygr) gene for antibiotic selection in mammalian cells. The TRE is derived from vectors described previously (2, 3). pRevTRE also includes the E. coli Ampr gene for antibiotic selection in bacteria.

 

pRevTRE  Sequence

LOCUS       Exported                6487 bp ds-DNA     circular SYN 05-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 4

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6487)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Monday, September 5, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..6487

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     LTR             414..589

                     /note="5' LTR (truncated)"

                     /note="truncated long terminal repeat from Moloney murine 

                     sarcoma virus"

     misc_feature    652..851

                     /note="MMLV Psi"

                     /note="packaging signal of Moloney murine leukemia virus 

                     (MMLV)"

     CDS             1052..1468

                     /note="gag (truncated)"

                     /note="truncated Moloney murine leukemia virus (MMLV) gag 

                     gene lacking the start codon"

     CDS             1524..2543

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /note="HygR"

                     /note="confers resistance to hygromycin"

                     /translation="KPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYV

                     LRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPET

                     ELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTV

                     MDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGD

                     SQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNF

                     DDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE"

     protein_bind    2847..3117

                     /bound_moiety="tetracycline repressor TetR"

                     /note="tetracycline response element"

                     /note="contains seven copies of the tetracycline operator 

                     tetO"

     promoter        3150..3187

                     /note="minimal CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     misc_feature    3281..3337

                     /note="MCS"

                     /note="pUC18/19 multiple cloning site"

     LTR             3389..3982

                     /note="long terminal repeat from Moloney murine leukemia 

                     virus"

     misc_feature    4193..4333

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(4519..5107)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(5278..6138)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(6139..6243)

                     /gene="bla"

                     /note="AmpR promoter"

ORIGIN

        1 tttgaaagac cccacccgta ggtggcaagc tagcttaagt aacgccactt tgcaaggcat

       61 ggaaaaatac ataactgaga atagaaaagt tcagatcaag gtcaggaaca aagaaacagc

      121 tgaataccaa acaggatatc tgtggtaagc ggttcctgcc ccggctcagg gccaagaaca

      181 gatgagacag ctgagtgatg ggccaaacag gatatctgtg gtaagcagtt cctgccccgg

      241 ctcggggcca agaacagatg gtccccagat gcggtccagc cctcagcagt ttctagtgaa

      301 tcatcagatg tttccagggt gccccaagga cctgaaaatg accctgtacc ttatttgaac

      361 taaccaatca gttcgcttct cgcttctgtt cgcgcgcttc cgctctccga gctcaataaa

      421 agagcccaca acccctcact cggcgcgcca gtcttccgat agactgcgtc gcccgggtac

      481 ccgtattccc aataaagcct cttgctgttt gcatccgaat cgtggtctcg ctgttccttg

      541 ggagggtctc ctctgagtga ttgactaccc acgacggggg tctttcattt gggggctcgt

      601 ccgggatttg gagacccctg cccagggacc accgacccac caccgggagg taagctggcc

      661 agcaacttat ctgtgtctgt ccgattgtct agtgtctatg tttgatgtta tgcgcctgcg

      721 tctgtactag ttagctaact agctctgtat ctggcggacc cgtggtggaa ctgacgagtt

      781 ctgaacaccc ggccgcaacc ctgggagacg tcccagggac tttgggggcc gtttttgtgg

      841 cccgacctga ggaagggagt cgatgtggaa tccgaccccg tcaggatatg tggttctggt

      901 aggagacgag aacctaaaac agttcccgcc tccgtctgaa tttttgcttt cggtttggaa

      961 ccgaagccgc gcgtcttgtc tgctgcagcg ctgcagcatc gttctgtgtt gtctctgtct

     1021 gactgtgttt ctgtatttgt ctgaaaatta gggccagact gttaccactc ccttaagttt

     1081 gaccttaggt cactggaaag atgtcgagcg gatcgctcac aaccagtcgg tagatgtcaa

     1141 gaagagacgt tgggttacct tctgctctgc agaatggcca acctttaacg tcggatggcc

     1201 gcgagacggc acctttaacc gagacctcat cacccaggtt aagatcaagg tcttttcacc

     1261 tggcccgcat ggacacccag accaggtccc ctacatcgtg acctgggaag ccttggcttt

     1321 tgacccccct ccctgggtca agccctttgt acaccctaag cctccgcctc ctcttcctcc

     1381 atccgccccg tctctccccc ttgaacctcc tcgttcgacc ccgcctcgat cctcccttta

     1441 tccagccctc actccttctc taggcgccgg aattccgatc tgatagcttg ccacaacccg

     1501 taccaaagat ggatagatcc ggaaagcctg aactcaccgc gacgtctgtc gagaagtttc

     1561 tgatcgaaaa gttcgacagc gtctccgacc tgatgcagct ctcggagggc gaagaatctc

     1621 gtgctttcag cttcgatgta ggagggcgtg gatatgtcct gcgggtaaat agctgcgccg

     1681 atggtttcta caaagatcgt tatgtttatc ggcactttgc atcggccgcg ctcccgattc

     1741 cggaagtgct tgacattggg gaattcagcg agagcctgac ctattgcatc tcccgccgtg

     1801 cacagggtgt cacgttgcaa gacctgcctg aaaccgaact gcccgctgtt ctgcagccgg

     1861 tcgcggaggc catggatgcg atcgctgcgg ccgatcttag ccagacgagc gggttcggcc

     1921 cattcggacc gcaaggaatc ggtcaataca ctacatggcg tgatttcata tgcgcgattg

     1981 ctgatcccca tgtgtatcac tggcaaactg tgatggacga caccgtcagt gcgtccgtcg

     2041 cgcaggctct cgatgagctg atgctttggg ccgaggactg ccccgaagtc cggcacctcg

     2101 tgcacgcgga tttcggctcc aacaatgtcc tgacggacaa tggccgcata acagcggtca

     2161 ttgactggag cgaggcgatg ttcggggatt cccaatacga ggtcgccaac atcttcttct

     2221 ggaggccgtg gttggcttgt atggagcagc agacgcgcta cttcgagcgg aggcatccgg

     2281 agcttgcagg atcgccgcgg ctccgggcgt atatgctccg cattggtctt gaccaactct

     2341 atcagagctt ggttgacggc aatttcgatg atgcagcttg ggcgcagggt cgatgcgacg

     2401 caatcgtccg atccggagcc gggactgtcg ggcgtacaca aatcgcccgc agaagcgcgg

     2461 ccgtctggac cgatggctgt gtagaagtac tcgccgatag tggaaaccga cgccccagca

     2521 ctcgtccgag ggcaaaggaa tagagtagat gccgaccgaa caagagctga tttcgagaac

     2581 gcctcagcca gcaactcgcg cgagcctagc aaggcaaatg cgagagaacg gccttacgct

     2641 tggtggcaca gttctcgtcc acagttcgct aagctcgctc ggctgggtcg cgggagggcc

     2701 ggtcgcagtg attcaggccc ttctggattg tgttggtccc cagggcacga ttgtcatgcc

     2761 cacgcactcg ggtgatctga ctgatcccgc agattggaga tcgccgcccg tgcctgccga

     2821 ttgggtgcag atctcgagtt taccactccc tatcagtgat agagaaaagt gaaagtcgag

     2881 tttaccactc cctatcagtg atagagaaaa gtgaaagtcg agtttaccac tccctatcag

     2941 tgatagagaa aagtgaaagt cgagtttacc actccctatc agtgatagag aaaagtgaaa

     3001 gtcgagttta ccactcccta tcagtgatag agaaaagtga aagtcgagtt taccactccc

     3061 tatcagtgat agagaaaagt gaaagtcgag tttaccactc cctatcagtg atagagaaaa

     3121 gtgaaagtcg agctcggtac ccgggtcgag taggcgtgta cggtgggagg cctatataag

     3181 cagagctcgt ttagtgaacc gtcagatcgc ctggagacgc catccacgct gttttgacct

     3241 ccatagaaga caccgggacc gatccagcct ccgcggcccc gaattcgagc tcggtacccg

     3301 gggatcctct agagtcgacc tgcaggcatg caagcttgtt aacatcgata aaataaaaga

     3361 ttttatttag tctccagaaa aaggggggaa tgaaagaccc cacctgtagg tttggcaagc

     3421 tagcttaagt aacgccattt tgcaaggcat ggaaaaatac ataactgaga atagagaagt

     3481 tcagatcaag gtcaggaaca gatggaacag ctgaatatgg gccaaacagg atatctgtgg

     3541 taagcagttc ctgccccggc tcagggccaa gaacagatgg aacagctgaa tatgggccaa

     3601 acaggatatc tgtggtaagc agttcctgcc ccggctcagg gccaagaaca gatggtcccc

     3661 agatgcggtc cagccctcag cagtttctag agaaccatca gatgtttcca gggtgcccca

     3721 aggacctgaa atgaccctgt gccttatttg aactaaccaa tcagttcgct tctcgcttct

     3781 gttcgcgcgc ttctgctccc cgagctcaat aaaagagccc acaacccctc actcggggcg

     3841 ccagtcctcc gattgactga gtcgcccggg tacccgtgta tccaataaac cctcttgcag

     3901 ttgcatccga cttgtggtct cgctgttcct tgggagggtc tcctctgagt gattgactac

     3961 ccgtcagcgg gggtctttca tttgggggct cgtccgggat cgggagaccc ctgcccaggg

     4021 accaccgacc caccaccggg aggtaagctg gctgcctcgc gcgtttcggt gatgacggtg

     4081 aaaacctctg acacatgcag ctcccggaga cggtcacagc ttgtctgtaa gcggatgccg

     4141 ggagcagaca agcccgtcag ggcgcgtcag cgggtgttgg cgggtgtcgg ggcgcagcca

     4201 tgacccagtc acgtagcgat agcggagtgt atactggctt aactatgcgg catcagagca

     4261 gattgtactg agagtgcacc atatgcggtg tgaaataccg cacagatgcg taaggagaaa

     4321 ataccgcatc aggcgctctt ccgcttcctc gctcactgac tcgctgcgct cggtcgttcg

     4381 gctgcggcga gcggtatcag ctcactcaaa ggcggtaata cggttatcca cagaatcagg

     4441 ggataacgca ggaaagaaca tgtgagcaaa aggccagcaa aaggccagga accgtaaaaa

     4501 ggccgcgttg ctggcgtttt tccataggct ccgcccccct gacgagcatc acaaaaatcg

     4561 acgctcaagt cagaggtggc gaaacccgac aggactataa agataccagg cgtttccccc

     4621 tggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg cttaccggat acctgtccgc

     4681 ctttctccct tcgggaagcg tggcgctttc tcatagctca cgctgtaggt atctcagttc

     4741 ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa ccccccgttc agcccgaccg

     4801 ctgcgcctta tccggtaact atcgtcttga gtccaacccg gtaagacacg acttatcgcc

     4861 actggcagca gccactggta acaggattag cagagcgagg tatgtaggcg gtgctacaga

     4921 gttcttgaag tggtggccta actacggcta cactagaagg acagtatttg gtatctgcgc

     4981 tctgctgaag ccagttacct tcggaaaaag agttggtagc tcttgatccg gcaaacaaac

     5041 caccgctggt agcggtggtt tttttgtttg caagcagcag attacgcgca gaaaaaaagg

     5101 atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagtgga acgaaaactc

     5161 acgttaaggg attttggtca tgagattatc aaaaaggatc ttcacctaga tccttttaaa

     5221 ttaaaaatga agttttaaat caatctaaag tatatatgag taaacttggt ctgacagtta

     5281 ccaatgctta atcagtgagg cacctatctc agcgatctgt ctatttcgtt catccatagt

     5341 tgcctgactc cccgtcgtgt agataactac gatacgggag ggcttaccat ctggccccag

     5401 tgctgcaatg ataccgcgag acccacgctc accggctcca gatttatcag caataaacca

     5461 gccagccgga agggccgagc gcagaagtgg tcctgcaact ttatccgcct ccatccagtc

     5521 tattaattgt tgccgggaag ctagagtaag tagttcgcca gttaatagtt tgcgcaacgt

     5581 tgttgccatt gctgcaggca tcgtggtgtc acgctcgtcg tttggtatgg cttcattcag

     5641 ctccggttcc caacgatcaa ggcgagttac atgatccccc atgttgtgca aaaaagcggt

     5701 tagctccttc ggtcctccga tcgttgtcag aagtaagttg gccgcagtgt tatcactcat

     5761 ggttatggca gcactgcata attctcttac tgtcatgcca tccgtaagat gcttttctgt

     5821 gactggtgag tactcaacca agtcattctg agaatagtgt atgcggcgac cgagttgctc

     5881 ttgcccggcg tcaacacggg ataataccgc gccacatagc agaactttaa aagtgctcat

     5941 cattggaaaa cgttcttcgg ggcgaaaact ctcaaggatc ttaccgctgt tgagatccag

     6001 ttcgatgtaa cccactcgtg cacccaactg atcttcagca tcttttactt tcaccagcgt

     6061 ttctgggtga gcaaaaacag gaaggcaaaa tgccgcaaaa aagggaataa gggcgacacg

     6121 gaaatgttga atactcatac tcttcctttt tcaatattat tgaagcattt atcagggtta

     6181 ttgtctcatg agcggataca tatttgaatg tatttagaaa aataaacaaa taggggttcc

     6241 gcgcacattt ccccgaaaag tgccacctga cgtctaagaa accattatta tcatgacatt

     6301 aacctataaa aataggcgta tcacgaggcc ctttcgtctt caagaattca taccagatca

     6361 ccgaaaactg tcctccaaat gtgtccccct cacactccca aattcgcggg cttctgcctc

     6421 ttagaccact ctaccctatt ccccacactc accggagcca aagccgcggc ccttccgttt

     6481 ctttgct

//

 

Caution:
Product is for research use only!

 

Search name

pRevTRE,Plasmid pRevTRE,pRevTRE vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart