pRI101- AN

$260.00

  • Model: PVT11185
  • 50 Units in Stock
Ask a question


Add to Cart:

pRI101-AN

Catalog No. PVT11185
Packing 2ug

 

pRI101-AN Information
Function plant expression plasmid

Promoter: 35S

Prokaryotic resistance: kanamycin Kan

Screening markers: Mycophenolate G418

Cloned strain: Escherichia coli HB101

Culture conditions: 37 degrees centigrade

 

pRI101-AN Description

PRI101-AN vector is a vector expressing foreign genes in dicotyledonous plant cells. Use of Agrobacterium tumefaciens.

pRI101 DNA vectors are binary plant transformation vectors intended for foreign gene expression in plant cells. These agrobacterium-mediated plant transformation vectors carry the 35S promoter of caμliflower mosaic virus (CaMV) and the 5’ non-coding region (5’-UTR) of the alcohol dehydrogenase (ADH) gene. The 5’-UTR of ADH functions as a translation enhancer in plants. There are two types of pRI101 DNA vectors, the pRI101-AN DNA vector, which carries the 5’-UTR of Arabidopsis ADH (AtADH 5’-UTR), and the pRI101 ON DNA vector, which carries the 5’-UTR of rice ADH (OsADH 5’-UTR). The pRI101-AN DNA vector is for dicotyledonous plants such as tobacco or Arabidopsis while the pRI101-ON DNA vector is for monocotyledonous plants such as rice.Although the pRI101 DNA vectors are shuttle vectors and replicate autonomously in E. coli and Rhizobium (Agrobacterium), they are high copy number plasmids because they contain the same replication origin as pUC-type plasmids (ColE1 ori). These vectors are also stably maintained in Rhizobium (Agrobacterium) containing the mutant-type replication origin Ri (Ri-ori). The pRI101 DNA vectors are capable of stably integrating target genes into plant chromosomes because the vector cloning sites are located closer to the Right Border (RB) of T-DNA than the selection marker (NPT II) of the plant, so the target gene is not deleted.

pRI101-AN-vector

 

 

pRI101-AN Sequence

LOCUS       Exported               10417 bp ds-DNA     circular SYN 23-NOV-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..10417
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      complement(57..645)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number colE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6419..7213)
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin)"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     promoter        7620..7650
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    7658..7674
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     7682..7698
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(9017..9033)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
ORIGIN
        1 tgagcaaaag gccagcaaaa ggccaggaac cgtaaaaagg ccgcgttgct ggcgtttttc
       61 cataggctcc gcccccctga cgagcatcac aaaaatcgac gctcaagtca gaggtggcga
      121 aacccgacag gactataaag ataccaggcg tttccccctg gaagctccct cgtgcgctct
      181 cctgttccga ccctgccgct taccggatac ctgtccgcct ttctcccttc gggaagcgtg
      241 gcgctttctc atagctcacg ctgtaggtat ctcagttcgg tgtaggtcgt tcgctccaag
      301 ctgggctgtg tgcacgaacc ccccgttcag cccgaccgct gcgccttatc cggtaactat
      361 cgtcttgagt ccaacccggt aagacacgac ttatcgccac tggcagcagc cactggtaac
      421 aggattagca gagcgaggta tgtaggcggt gctacagagt tcttgaagtg gtggcctaac
      481 tacggctaca ctagaagaac agtatttggt atctgcgctc tgctgaagcc agttaccttc
      541 ggaaaaagag ttggtagctc ttgatccggc aaacaaacca ccgctggtag cggtggtttt
      601 tttgtttgca agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga tcctttgatc
      661 ttttctacgg ggtctgacgc tcagtggaac gaaaactcac gttaagggat tttggtcatg
      721 agattatcaa aaaggatctt cacctagatc cttttaaatt aaaaatgaag ttttaaatca
      781 atctaaagta tatatgagta aacttggtct gacagttacc aatgcttaat cagtgaggca
      841 cctatctcag cgatctgtct atttcgttca tccatagttg cctgactcga tcctacaagg
      901 tagaatccgc ctgagtcgca agggtgactt cgcctatatt ggacgacggc gcgcagaggg
      961 cgacctcttt ttgggttacg attgtaggat tatcactaaa acaatacatg aacatattca
     1021 aatggcaatc tctctaaggc attggaaata aatacaaata acagttgggt ggagtttttc
     1081 gacctgaggg cgttaacctt ctgttaacct aaaagctctt gcccaaacag cagaatcggc
     1141 gctaattgcc agcggcggaa cttttccagt ttcgcgaaaa atatcgccac tggcaaggaa
     1201 tgggtttgag atggcgaagt ctgtcctaaa agcagcgcct gtagttgtag ggttgacggc
     1261 cttgatggag cgtcatgccg atgccctctc gagccaactt caagcacatc atcttaaggt
     1321 tttcccgccg cattccgaga agggtattcg aacattcggg ccatcggagg cgtccaagct
     1381 gctcggcgtt ggcgagtcat atttacggca gaccgcgtct gagatgccag agttgaatgt
     1441 tagcatgagc ccaggtggca ggcgaatgtt ctcaattgaa gatatccatg tgattcggaa
     1501 gtatatggat caggtcggcc gcgggaaccg gcgctacctg ccacatcgtc gaggcggcga
     1561 gcagcttcag gttatctctg tgatgaattt caaaggtggg tcgggtaaga ccaccaccgc
     1621 cgcgcatctg gcgcagtacc tcgctatgcg cggatatcga gtcttggcca ttgatctcga
     1681 tcctcaagcg agcctttctg cactctttgg gagccaaccg gagacggacg ttggcccgaa
     1741 cgaaacgctc tacggcgcta taaggtatga tgatgagcag gtggcaatcg aacgagtcgt
     1801 ccgagggact tacattcccg acctccacct gattcctggt aaccttgagc tgatggagtt
     1861 tgaacacgat acgccacgcg cgctgatgaa ccgcaaagag ggcgacacgc tcttttatgg
     1921 tcgcatcagc caagtaattg aagatatcgc ggataactat gacgtcgtgg tcatcgactg
     1981 ccctccccag cttgggtatc tcacgctatc cgcattgact gcggcgacgt ccattcttgt
     2041 cacggtccat ccgcagatgc tggatgtgat gtcgatgaac cagtttctgg caatgacatc
     2101 gaaccttttg cgtgaaatcg agaatgctgg cgccaagttc aagtttaatt ggatgcgcta
     2161 tctgataacc cgtttcgaac cgagcgacgg accacagaac caaatggtag gttatctgcg
     2221 gtcgattttt ggcgaaaatg tcctcaattt tccgatgctt aaaaccaccg cggtttcgga
     2281 cgctggcctg acaaaccaga ctctattcga agtggagcgt ggcctgttca cgcgctcgac
     2341 ctatgatcga gccttggagg cgatgaacgc cgtcaacgac gagatcgaaa cactgatcaa
     2401 aaaagcatgg ggtaggccca catgagccgg aagcacatcc ttggcgtctc aactgacgcc
     2461 cctgagacgt cgcccgccga caataggacg gcaaagaacc gctccatgcc gctcctcggc
     2521 gtaacaagga aggagcgcga tccggcaacg aagctcacag cgaacattgg taacgcactg
     2581 cgagagcaaa acgatcgtct tagccgtgcc gaagagatcg agcggcgtct cgctgaaggt
     2641 caggcagtga tagagttgga tgcctcgtca atagaaccgt ctttcgtgca ggatcgtatg
     2701 cgaggggaca ttgacgggct ccttacttcg atccgggaac aaggacagca agtcccaatc
     2761 cttgtgcgac cgcatccgag ccagccgggc cgatatcagg ttgccttcgg ccaccgccgg
     2821 ctacgcgccg tttcagaact cggacttccg gtcagggcgg tcgttcgcga actgacggac
     2881 gagcaagtgg tcgtagcaca gggtcaggaa aacaatgtgc gcgaagatct taccttcatc
     2941 gaaaaggcgc gcttcgcaca tcgcctgaac aggcagtttt ctcgagagat tgtcatcgcc
     3001 gcgatgtcga tcgacaagag caatttgtcc aagatgcttc tgctcgttga cgccctcccc
     3061 tctgaactga ccgatgctat tggtgccgct cctggtgttg gacggccgag ttggcaacaa
     3121 cttgccgagc tgattgagaa agtttcttca ccggccgacg tggctaaata tgctatgtcg
     3181 gaggaagttc aagcgctgcc atcggcagaa cgattcaagg cggtgatcgc tagtctgaag
     3241 cccagtcggg ttgcgcgtgg acttcccgag gtcatggcca ccccagacgg caccagaatt
     3301 gcacaggtga cgcagagcaa ggccaaactg gaaatcacga ttgacaggaa ggcgacgccc
     3361 gattttgcga ccttcgtgct cgatcatgtg ccagcgctgt atcaagcgta ccacgctgag
     3421 aaccaacgga aacggggaga gtaaaccgca aaagaaaaga gccccctcaa cgtcgccgtc
     3481 gcggaagccc ttctgtctct ctagcgcgaa cagaatcgca tttcctcgaa tcctcgtcaa
     3541 gagtttttag cgccgttttg gtgagctgat ttcctttgcc tgctgaaagg tgaaagatga
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart