pRK415 Plasmid

$216.00

  • Model: PVT5709
  • 49 Units in Stock
Ask a question


Add to Cart:

pRK415

PVT5709  2ug
 

Search name

pRK415,Plasmid pRK415,pRK415 vector

 

pRK415 Information

Promoter: Lac/lac

Replicon: oriV

Plasmid classification: the plasmids of the broad host

Plasmid size: 10690bp

Plasmid label: traJ, LacZ

Prokaryotic resistance: tetracycline Tetracyclin

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

5'sequencing primers: M13R:CAGGAAACAGCTATGACC

3'sequencing primers: M13F:TGTAAAACGACGGCCAGT

Expression: Bacterial

 

pRK415 Description

pRK415-polyclonal-site

 

 

pRK415 Sequence

LOCUS       Exported               10690 bp ds-DNA     circular SYN 06-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pRK415

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 10690)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Tuesday, September 6, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..10690

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      1..712

                     /note="oriV"

                     /note="incP origin of replication"

     CDS             complement(971..1312)

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /note="lacZ-alpha"

                     /translation="MTMITPSLHACRSTLEDPRVPSSNSLAVVLQRRDWENPGVTQLNR

                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRHASRREKGGQVSGKRQGRNRRAHEGA

                     SRGKRLVSL"

     primer_bind     1222..1238

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     misc_feature    1239..1295

                     /note="MCS"

                     /note="pUC18/19 multiple cloning site"

     primer_bind     complement(1308..1324)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    1332..1348

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(1356..1386)

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    1401..1422

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     CDS             complement(1654..2025)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /note="traJ"

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            2058..2167

                     /note="incP origin of transfer"

     CDS             complement(2848..3498)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /note="TetR"

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     CDS             3604..4803

                     /codon_start=1

                     /gene="tetA"

                     /product="tetracycline efflux protein"

                     /note="TcR"

                     /note="confers resistance to tetracycline"

                     /translation="MKPNIPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY

                     GILLALYALVQFACAPVLGALSDRFGRRPILLVSLAGATVDYAIMATAPFLWVLYIGRI

                     VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF

                     FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM

                     QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM

                     LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL

                     AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR

                     "

     CDS             complement(6074..7222)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /note="trfA"

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

ORIGIN

        1 ctgccatttt tggggtgagg ccgttcgcgg ccgaggggcg cagcccctgg ggggatggga

       61 ggcccgcgtt agcgggccgg gagggttcga gaaggggggg cacccccctt cggcgtgcgc

      121 ggtcacgcgc acagggcgca gccctggtta aaaacaaggt ttataaatat tggtttaaaa

      181 gcaggttaaa agacaggtta gcggtggccg aaaaacgggc ggaaaccctt gcaaatgctg

      241 gattttctgc ctgtggacag cccctcaaat gtcaataggt gcgcccctca tctgtcagca

      301 ctctgcccct caagtgtcaa ggatcgcgcc cctcatctgt cagtagtcgc gcccctcaag

      361 tgtcaatacc gcagggcact tatccccagg cttgtccaca tcatctgtgg gaaactcgcg

      421 taaaatcagg cgttttcgcc gatttgcgag gctggccagc tccacgtcgc cggccgaaat

      481 cgagcctgcc cctcatctgt caacgccgcg ccgggtgagt cggcccctca agtgtcaacg

      541 tccgcccctc atctgtcagt gagggccaag ttttccgcga ggtatccaca acgccggcgg

      601 ccgcggtgtc tcgcacacgg cttcgacggc gtttctggcg cgtttgcagg gccatagacg

      661 gccgccagcc cagcggcgag ggcaaccagc ccggtgagcg tcggaaaggc gctcttccgc

      721 ttcctcgctc actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca

      781 ctcaaaggcg gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg

      841 agcaaaaggc cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca

      901 taggctccgc ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa

      961 cccgacagga ctataaagat accaggcgtt tccccctgga agctccctcg tgcgctctcc

     1021 tgttccgacc ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc

     1081 gccattcgcc attcaggctg cgcaactgtt gggaagggcg atcggtgcgg gcctcttcgc

     1141 tattacgcca gctggcgaaa gggggatgtg ctgcaaggcg attaagttgg gtaacgccag

     1201 ggttttccca gtcacgacgt tgtaaaacga cggccagtga attcgagctc ggtacccggg

     1261 gatcctctag agtcgacctg caggcatgca agcttggcgt aatcatggtc atagctgttt

     1321 cctgtgtgaa attgttatcc gctcacaatt ccacacaaca tacgagccgg aagcataaag

     1381 tgtaaagcct ggggtgccta atgagtgagc taactcacat taattgcgtt gcgctcactg

     1441 cccgctttcc agtcgggaaa cctgtcgtgc cagctgcatt aatgaatcgg ccaacgcgcg

     1501 gggagaggcg gtttgcgtat tgggcgctcg gtcttgcctt gctcgtcggt gatgtacttc

     1561 accagctccg cgaagtcgct cttcttgatg gagcgcatgg ggacgtgctt ggcaatcacg

     1621 cgcacccccc ggccgtttta gcggctaaaa aagtcatggc tctgccctcg ggcggaccac

     1681 gcccatcatg accttgccaa gctcgtcctg cttctcttcg atcttcgcca gcagggcgag

     1741 gatcgtggca tcaccgaacc gcgccgtgcg cgggtcgtcg gtgagccaga gtttcagcag

     1801 gccgcccagg cggcccaggt cgccattgat gcgggccagc tcgcggacgt gctcatagtc

     1861 cacgacgccc gtgattttgt agccctggcc gacggccagc aggtaggccg acaggctcat

     1921 gccggccgcc gccgcctttt cctcaatcgc tcttcgttcg tctggaaggc agtacacctt

     1981 gataggtggg ctgcccttcc tggttggctt ggtttcatca gccatccgct tgccctcatc

     2041 tgttacgccg gcggtagccg gccagcctcg cagagcagga ttcccgttga gcaccgccag

     2101 gtgcgaataa gggacagtga agaaggaaca cccgctcgcg ggtgggccta cttcacctat

     2161 cctgcccggc tgacgccgtt ggatacacca aggaaagtct acacgaaccc tttggcaaaa

     2221 tcctgtatat cgtgcgaaaa aggatggata taccgaaaaa atcgctataa tgaccccgaa

     2281 gcagggttat gcagcggaaa agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc

     2341 cggtaagcgg cagggtcgga acaggagagc gcacgaggga gcttccaggg ggaaacgcct

     2401 ggtatcttta tagtcctgtc gggtttcgcc acctctgact tgagcgtcga tttttgtgat

     2461 gctcgtcagg ggggcggagc ctatggaaaa acgccagcaa cgcggccttt ttacggttcc

     2521 tggccttttg ctggcctttt gctcacatgt tctttcctgc gttatcccct gattctgtgg

     2581 ataaccgtat taccgccttt gagtgagctg ataccgctcg ccgcagccga acgaccgagc

     2641 gcagcgagtc agtgagcgag gaagcggaag agcgccagaa ggccgccaga gaggccgagc

     2701 gcggccgtga ggcttggacg ctagggcagg gcatgaaaaa gcccgtagcg ggctgctacg

     2761 ggcgtctgac gcggtggaaa gggggagggg atgttgtcta catggctctg ctgtagtgag

     2821 tgggttgcgc tccggcagcg gtcctgatca atcgtcaccc tttctcggtc cttcaacgtt

     2881 cctgacaacg agcctccttt tcgccaatcc atcgacaatc accgcgagtc cctgctcgaa

     2941 cgctgcgtcc ggaccggctt cgtcgaaggc gtctatcgcg gcccgcaaca gcggcgagag

     3001 cggagcctgt tcaacggtgc cgccgcgctc gccggcatcg ctgtcgccgg cctgctcctc

     3061 aagcacggcc ccaacagtga agtagctgat tgtcatcagc gcattgacgg cgtccccggc

     3121 cgaaaaaccc gcctcgcaga ggaagcgaag ctgcgcgtcg gccgtttcca tctgcggtgc

     3181 gcccggtcgc gtgccggcat ggatgcgcgc gccatcgcgg taggcgagca gcgcctgcct

     3241 gaagctgcgg gcattcccga tcagaaatga gcgccagtcg tcgtcggctc tcggcaccga

     3301 atgcgtatga ttctccgcca gcatggcttc ggccagtgcg tcgagcagcg cccgcttgtt

     3361 cctgaagtgc cagtaaagcg ccggctgctg aacccccaac cgttccgcca gtttgcgtgt

     3421 cgtcagaccg tctacgccga cctcgttcaa caggtccagg gcggcacgga tcactgtatt

     3481 cggctgcaac tttgtcatgc ttgacacttt atcactgata aacataatat gtccaccaac

     3541 ttatcagtga taaagaatcc gcgcgttcaa tcggaccagc ggaggctggt ccggaggcca

     3601 gacatgaaac ccaacatacc cctgatcgta attctgagca ctgtcgcgct cgacgctgtc

     3661 ggcatcggcc tgattatgcc ggtgctgccg ggcctcctgc gcgatctggt tcactcgaac

     3721 gacgtcaccg cccactatgg cattctgctg gcgctgtatg cgttggtgca atttgcctgc

     3781 gcacctgtgc tgggcgcgct gtcggatcgt ttcgggcggc ggccaatctt gctcgtctcg

     3841 ctggccggcg ccactgtcga ctacgccatc atggcgacag cgcctttcct ttgggttctc

     3901 tatatcgggc ggatcgtggc cggcatcacc ggggcgactg gggcggtagc cggcgcttat

     3961 attgccgata tcactgatgg cgatgagcgc gcgcggcact tcggcttcat gagcgcctgt

     4021 ttcgggttcg ggatggtcgc gggacctgtg ctcggtgggc tgatgggcgg tttctccccc

     4081 cacgctccgt tcttcgccgc ggcagccttg aacggcctca atttcctgac gggctgtttc

     4141 cttttgccgg agtcgcacaa aggcgaacgc cggccgttac gccgggaggc tctcaacccg

     4201 ctcgcttcgt tccggtgggc ccggggcatg accgtcgtcg ccgccctgat ggcggtcttc

     4261 ttcatcatgc aacttgtcgg acaggtgccg gccgcgcttt gggtcatttt cggcgaggat

     4321 cgctttcact gggacgcgac cacgatcggc atttcgcttg ccgcatttgg cattctgcat

     4381 tcactcgccc aggcaatgat caccggccct gtagccgccc ggctcggcga aaggcgggca

     4441 ctcatgctcg gaatgattgc cgacggcaca ggctacatcc tgcttgcctt cgcgacacgg

     4501 ggatggatgg cgttcccgat catggtcctg cttgcttcgg gtggcatcgg aatgccggcg

     4561 ctgcaagcaa tgttgtccag gcaggtggat gaggaacgtc aggggcagct gcaaggctca

     4621 ctggcggcgc tcaccagcct gacctcgatc gtcggacccc tcctcttcac ggcgatctat

     4681 gcggcttcta taacaacgtg gaacgggtgg gcatggattg caggcgctgc cctctacttg

     4741 ctctgcctgc cggcgctgcg tcgcgggctt tggagcggcg cagggcaacg agccgatcgc

     4801 tgatcgtgga aacgataggc ctatgccatg cgggtcaagg cgacttccgg caagctatac

     4861 gcgccctagg agtgcggttg gaacgttggc ccagccagat actcccgatc acgagcagga

     4921 cgccgatgat ttgaagcgca ctcagcgtct gatccaagaa caaccatcct agcaacacgg

     4981 cggtccccgg gctgagaaag cccagtaagg aaacaactgt aggttcgagt cgcgagatcc

     5041 cccggaacca aaggaagtag gttaaacccg ctccgatcag gccgagccac gccaggccga

     5101 gaacattggt tcctgtaggc atcgggattg gcggatcaaa cactaaagct actggaacga

     5161 gcagaagtcc tccggccgcc agttgccagg cggtaaaggt gagcagaggc acgggaggtt

     5221 gccacttgcg ggtcagcacg gttccgaacg ccatggaaac cgcccccgcc aggcccgctg

     5281 cgacgccgac aggatctagc gctgcgtttg gtgtcaacac caacagcgcc acgcccgcag

     5341 ttccgcaaat agcccccagg accgccatca atcgtatcgg gctacctagc agagcggcag

     5401 agatgaacac gaccatcagc ggctgcacag cgcctaccgt cgccgcgacc cgcccggcag

     5461 gcggtagacc gaaataaaca acaagctcca gaatagcgaa atattaagtg cgccgaggat

     5521 gaagatgcgc atccaccaga ttcccgttgg aatctgtcgg acgatcatca cgagcaataa

     5581 acccgccggc aacgcccgca gcagcatacc ggcgacccct cggcctcgct gttcgggctc

     5641 cacgaaaacg ccggacagat gcgccttgtg agcgtccttg gggccgtcct cctgtttgaa

     5701 gaccgacagc ccaatgatct cgccgtcgat gtaggcgccg aatgccacgg catctcgcaa

     5761 ccgttcagcg aacgcctcca tgggcttttt ctcctcgtgc tcgtaaacgg acccgaacat

     5821 ctctggagct ttcttcaggg ccgacaatcg gatctcgcgg aaatcctgca cgtcggccgc

     5881 tccaagccgt cgaatctgag ccttaatcac aattgtcaat tttaatcctc tgtttatcgg

     5941 cagttcgtag agcgcgccgt gcgcccgagc gatactgagc gaagcaagtg cgtcgagcag

     6001 tgcccgcttg ttcctgaaat gccagtaaag cgctggctgc tgaaccccca gccggaactg

     6061 accccacaag gccctagcgt ttgcaatgca ccaggtcatc attgacccag gcgtgttcca

     6121 ccaggccgct gcctcgcaac tcttcgcagg cttcgccgac ctgctcgcgc cacttcttca

     6181 cgcgggtgga atccgatccg cacatgaggc ggaaggtttc cagcttgagc gggtacggct

     6241 cccggtgcga gctgaaatag tcgaacatcc gtcgggccgt cggcgacagc ttgcggtact

     6301 tctcccatat gaatttcgtg tagtggtcgc cagcaaacag cacgacgatt tcctcgtcga

     6361 tcaggacctg gcaacgggac gttttcttgc cacggtccag gacgcggaag cggtgcagca

     6421 gcgacaccga ttccaggtgc ccaacgcggt cggacgtgaa gcccatcgcc gtcgcctgta

     6481 ggcgcgacag gcattcctcg gccttcgtgt aataccggcc attgatcgac cagcccaggt

     6541 cctggcaaag ctcgtagaac gtgaaggtga tcggctcgcc gataggggtg cgcttcgcgt

     6601 actccaacac ctgctgccac accagttcgt catcgtcggc ccgcagctcg acgccggtgt

     6661 aggtgatctt cacgtccttg ttgacgtgga aaatgacctt gttttgcagc gcctcgcgcg

     6721 ggattttctt gttgcgcgtg gtgaacaggg cagagcgggc cgtgtcgttt ggcatcgctc

     6781 gcatcgtgtc cggccacggc gcaatatcga acaaggaaag ctgcatttcc ttgatctgct

     6841 gcttcgtgtg tttcagcaac gcggcctgct tggcctcgct gacctgtttt gccaggtcct

     6901 cgccggcggt ttttcgcttc ttggtcgtca tagttcctcg cgtgtcgatg gtcatcgact

     6961 tcgccaaacc tgccgcctcc tgttcgagac gacgcgaacg ctccacggcg gccgatggcg

     7021 cgggcagggc agggggagcc agttgcacgc tgtcgcgctc gatcttggcc gtagcttgct

     7081 ggaccatcga gccgacggac tggaaggttt cgcggggcgc acgcatgacg gtgcggcttg

     7141 cgatggtttc ggcatcctcg gcggaaaacc ccgcgtcgat cagttcttgc ctgtatgcct

     7201 tccggtcaaa cgtccgattc attcaccctc cttgcgggat tgccccgact cacgccgggg

     7261 caatgtgccc ttattcctga tttgacccgc ctggtgcctt ggtgtccaga taatccacct

     7321 tatcggcaat gaagtcggtc ccgtagaccg tctggccgtc cttctcgtac ttggtattcc

     7381 gaatcttgcc ctgcacgaat accagcgacc ccttgcccaa atacttgccg tgggcctcgg

     7441 cctgagagcc aaaacacttg atgcggaaga agtcggtgcg ctcctgcttg tcgccggcat

     7501 cgttgcgcca ctcttcatta accgctatat cgaaaattgc ttgcggcttg ttagaattgc

     7561 catgacgtac ctcggtgtca cgggtaagat taccgataaa ctggaactga ttatggctca

     7621 tatcgaaagt ctccttgaga aaggagactc tagtttagct aaacattggt tccgctgtca

     7681 agaactttag cggctaaaat tttgcgggcc gcgaccaaag gtgcgagggg cggcttccgc

     7741 tgtgtacaac cagatatttt tcaccaacat ccttcgtctg ctcgatgagc ggggcatgac

     7801 gaaacatgag ctgtcggaga gggcaggggt ttcaatttcg tttttatcag acttaaccaa

     7861 cggtaaggcc aacccctcgt tgaaggtgat ggaggccatt gccgacgccc tggaaactcc

     7921 cctacctctt ctcctggagt ccaccgacct tgaccgcgag gcactcgcgg agattgcggg

     7981 tcatcctttc aagagcagcg tgccgcccgg atacgaacgc atcagtgtgg ttttgccgtc

     8041 acataaggcg tttatcgtaa agaaatgggg cgacgacacc cgaaaaaagc tgcgtggaag

     8101 gctctgacgc caagggttag ggcttgcact tccttcttta gccgctaaaa cggccccttc

     8161 tctgcgggcc gtcggctcgc gcatcatatc gacatcctca acggaagccg tgccgcgaat

     8221 ggcatcgggc gggtgcgctt tgacagttgt tttctatcag aacccctacg tcgtgcggtt

     8281 cgattagctg tttgtcttgc aggctaaaca ctttcggtat atcgtttgcc tgtgcgataa

     8341 tgttgctaat gatttgttgc gtaggggtta ctgaaaagtg agcgggaaag aagagtttca

     8401 gaccatcaag gagcgggcca agcgcaagct ggaacgcgac atgggtgcgg acctgttggc

     8461 cgcgctcaac gacccgaaaa ccgttgaagt catgctcaac gcggacggca aggtgtggca

     8521 cgaacgcctt ggcgagccga tgcggtacat ctgcgacatg cggcccagcc agtcgcaggc

     8581 gattatagaa acggtggccg gattccacgg caaagaggtc acgcggcatt cgcccatcct

     8641 ggaaggcgag ttccccttgg atggcagccg ctttgccggc caattgccgc cggtcgtggc

     8701 cgcgccaacc tttgcgatcc gcaagcgcgc ggtcgccatc ttcacgctgg aacagtacgt

     8761 cgaggcgggc atcatgaccc gcgagcaata cgaggtcatt aaaagcgccg tgattgatga

     8821 tatagcggcc cggctgctcc tggttctcgc gcaccgaaat gggtgacttc accccgcgct

     8881 ctttgatcgt ggcaccgatt tccgcgatgc tctccgggga aaagccgggg ttgtcggccg

     8941 tccgcggctg atgcggatct tcgtcgatca ggtccaggtc cagctcgata gggccggaac

     9001 cgccctgaga cgccgcagga gcgtccagga ggctcgacag gtcgccgatg ctatccaacc

     9061 ccaggccgga cggctgcgcc gcgcctgcgg cttcctgagc ggccgcagcg gtgtttttct

     9121 tggtggtctt ggcttgagcc gcagtcattg ggaaatctcc atcttcgtga acacgtaatc

     9181 agccagggcg cgaacctctt tcgatgcctt gcgcgcggcc gttttcttga tcttccagac

     9241 cggcacaccg gatgcgaggg catcggcgat gctgctgcgc aggccaacgg tggccggaat

     9301 catcatcttg gggtacgcgg ccagcagctc ggcttggtgg cgcgcgtggc gcggattccg

     9361 cgcatcgacc ttgctgggca ccatgccaag gaattgcagc ttggcgttct tctggcgcac

     9421 gttcgcaatg gtcgtgacca tcttcttgat gccctggatg ctgtacgcct caagctcgat

     9481 gggggacagc acatagtcgg ccgcgaagag ggcggccgcc aggccgacgc caagggtcgg

     9541 ggccgtgtcg atcaggcaca cgtcgaagcc ttggttcgcc agggccttga tgttcgcccc

     9601 gaacagctcg cgggcgtcgt ccagcgacag ccgttcggcg ttcgccagta ccgggttgga

     9661 ctcgatgagg gcgaggcgcg cggcctggcc gtcgccggct gcgggtgcgg tttcggtcca

     9721 gccgccggca gggacagcgc cgaacagctt gcttgcatgc aggccggtag caaagtcctt

     9781 gagcgtgtag gacgcattgc cctgggggtc caggtcgatc acggcaaccc gcaagccgcg

     9841 ctcgaaaaag tcgaaggcaa gatgcacaag ggtcgaagtc ttgccgacgc cgcctttctg

     9901 gttggccgtg accaaagttt tcatcgtttg gtttcctgtt ttttcttggc gtccgcttcc

     9961 cacttccgga cgatgtacgc ctgatgttcc ggcagaaccg ccgttacccg cgcgtacccc

    10021 tcgggcaagt tcttgtcctc gaacgcggcc cacacgcgat gcaccgcttg cgacactgcg

    10081 cccctggtca gtcccagcga cgttgcgaac gtcgcctgtg gcttcccatc gactaagacg

    10141 ccccgcgcta tctcgatggt ctgctgcccc acttccagcc cctggatcgc ctcctggaac

    10201 tggctttcgg taagccgttt cttcatggat aacacccata atttgctccg cgccttggtt

    10261 gaacatagcg gtgacagccg ccagcacatg agagaagttt agctaaacat ttctcgcacg

    10321 tcaacacctt tagccgctaa aactcgtcct tggcgtaaca aaacaaaagc ccggaaaccg

    10381 ggctttcgtc tcttgccgct tatggctctg cacccggctc catcaccaac aggtcgcgca

    10441 cgcgcttcac tcggttgcgg atcgacactg ccagcccaac aaagccggtt gccgccgccg

    10501 ccaggatcgc gccgatgatg ccggccacac cggccatcgc ccaccaggtc gccgccctca

    10561 ctgcccggca cctggtcgct gaatgtcgat gccagcacct gcggcacgtc aatgcttccg

    10621 ggcgtcgcgc tcgggctgat cgcccatccc gttactgccc cgatcccggc aatggcaagg

    10681 actgccagcg

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart