pRK5- HA

$182.00

  • Model: PVT11027
  • 50 Units in Stock
Ask a question


Add to Cart:

pRK5-HA


Catalog No. PVT11027
Packing 2ug
Function Mammal expression plasmid
Resistance Amp
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pUC
Copy high
Promoter CMV

 

pRK5-HA Multiple cloning sites

pRK5-HA-vector

 

pRK5-HA Sequence

LOCUS       Exported                4727 bp ds-DNA     circular SYN 20-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..4727

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        14..393

                     /label=CMV enhancer

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        394..597

                     /label=CMV promoter

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     promoter        828..846

                     /label=SP6 promoter

                     /note="promoter for bacteriophage SP6 RNA polymerase"

     regulatory      963..972

                     /regulatory_class="other"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     CDS             975..1001

                     /codon_start=1

                     /product="HA (human influenza hemagglutinin) epitope tag"

                     /label=HA

                     /translation="YPYDVPDYA"

     misc_feature    1001..1072

                     /label=MCS

     polyA_signal    1111..1245

                     /label=SV40 poly(A) signal

                     /note="SV40 polyadenylation signal"

     promoter        1381..1599

                     /label=SV40 promoter

                     /note="SV40 early promoter"

     rep_origin      1450..1585

                     /label=SV40 ori

                     /note="SV40 origin of replication"

     rep_origin      1848..2303

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2585..2689

                     /gene="bla"

                     /label=AmpR promoter

     CDS             2690..3550

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      3721..4310

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 ttcgagctcg cccgacattg attattgact agttattaat agtaatcaat tacggggtca

       61 ttagttcata gcccatatat ggagttccgc gttacataac ttacggtaaa tggcccgcct

      121 ggctgaccgc ccaacgaccc ccgcccattg acgtcaataa tgacgtatgt tcccatagta

      181 acgccaatag ggactttcca ttgacgtcaa tgggtggagt atttacggta aactgcccac

      241 ttggcagtac atcaagtgta tcatatgcca agtacgcccc ctattgacgt caatgacggt

      301 aaatggcccg cctggcatta tgcccagtac atgaccttat gggactttcc tacttggcag

      361 tacatctacg tattagtcat cgctattacc atggtgatgc ggttttggca gtacatcaat

      421 gggcgtggat agcggtttga ctcacgggga tttccaagtc tccaccccat tgacgtcaat

      481 gggagtttgt tttggcacca aaatcaacgg gactttccaa aatgtcgtaa caactccgcc

      541 ccattgacgc aaatgggcgg taggcgtgta cggtgggagg tctatataag cagagctcgt

      601 ttagtgaacc gtcagatcgc ctggagacgc catccacgct gttttgacct ccatagaaga

      661 caccgggacc gatccagcct ccgcggccgg gaacggtgca ttggaacgcg gattccccgt

      721 gccaagagtg acgtaagtac cgcctataga gtctataggc ccaccccctt ggcttcgtta

      781 gaacgcggct acaattaata cataacctta tgtatcatac acatacgatt taggtgacac

      841 tatagaataa catccacttt gcctttctct ccacaggtgt ccactcccag gtccaactgc

      901 acctcggttc tatcgattga attcccgaac cgacagtcgg tctcttcacc aaggccattc

      961 gcgccaccat gggctacccc tatgatgtgc ctgactacgc agatctcaat ggtggtggtg

     1021 gtgggtcgac gtacccgggc gtcaagcttg ctagatatcc gcatgcggcc gctaagtaag

     1081 taaggatccc cagcttggcc gccatggccc aacttgttta ttgcagctta taatggttac

     1141 aaataaagca atagcatcac aaatttcaca aataaagcat ttttttcact gcattctagt

     1201 tgtggtttgt ccaaactcat caatgtatct tatcatgtct ggatcgggaa ttaattcggc

     1261 gcagcaccat ggcctgaaat aacctctgaa agaggaactt ggttaggtac cttctgaggc

     1321 ggaaagaacc agctgtggaa tgtgtgtcag ttagggtgtg gaaagtcccc aggctcccca

     1381 gcaggcagaa gtatgcaaag catgcatctc aattagtcag caaccatagt cccgccccta

     1441 actccgccca tcccgcccct aactccgccc agttccgccc attctccgcc ccatggctga

     1501 ctaatttttt ttatttatgc agaggccgag gccgcctcgg cctctgagct attccagaag

     1561 tagtgaggag gcttttttgg aggcctaggc ttttgcaaaa agctgttaac agcttggcac

     1621 tggccgtcgt tttacaacgt cgtgactggg aaaaccctgg cgttacccaa cttaatcgcc

     1681 ttgcagcaca tccccctttc gccagctggc gtaatagcga agaggcccgc accgatcgcc

     1741 cttcccaaca gttgcgcagc ctgaatggcg aatggcgcct gatgcggtat tttctcctta

     1801 cgcatctgtg cggtatttca caccgcatac gtcaaagcaa ccatagtacg cgccctgtag

     1861 cggcgcatta agcgcggcgg gtgtggtggt tacgcgcagc gtgaccgcta cacttgccag

     1921 cgccctagcg cccgctcctt tcgctttctt cccttccttt ctcgccacgt tcgccggctt

     1981 tccccgtcaa gctctaaatc gggggctccc tttagggttc cgatttagtg ctttacggca

     2041 cctcgacccc aaaaaacttg atttgggtga tggttcacgt agtgggccat cgccctgata

     2101 gacggttttt cgccctttga cgttggagtc cacgttcttt aatagtggac tcttgttcca

     2161 aactggaaca acactcaacc ctatctcggg ctattctttt aatttataag ggattttgcc

     2221 gatttcggcc tattggttaa aaaatgagct gatttaacaa aaatttaacg cgaattttaa

     2281 caaaatatta acgtttacaa ttttatggtg cactctcagt acaatctgct ctgatgccgc

     2341 atagttaagc cagccccgac acccgccaac acccgctgac gcgccctgac gggcttgtct

     2401 gctcccggca tccgcttaca gacaagctgt gaccgtctcc gggagctgca tgtgtcagag

     2461 gttttcaccg tcatcaccga aacgcgcgag acgaaagggc ctcgtgatac gcctattttt

     2521 ataggttaat gtcatgataa taatggtttc ttagacgtca ggtggcactt ttcggggaaa

     2581 tgtgcgcgga acccctattt gtttattttt ctaaatacat tcaaatatgt atccgctcat

     2641 gagacaataa ccctgataaa tgcttcaata atattgaaaa aggaagagta tgagtattca

     2701 acatttccgt gtcgccctta ttcccttttt tgcggcattt tgccttcctg tttttgctca

     2761 cccagaaacg ctggtgaaag taaaagatgc tgaagatcag ttgggtgcac gagtgggtta

     2821 catcgaactg gatctcaaca gcggtaagat ccttgagagt tttcgccccg aagaacgttt

     2881 tccaatgatg agcactttta aagttctgct atgtggcgcg gtattatccc gtattgacgc

     2941 cgggcaagag caactcggtc gccgcataca ctattctcag aatgacttgg ttgagtactc

     3001 accagtcaca gaaaagcatc ttacggatgg catgacagta agagaattat gcagtgctgc

     3061 cataaccatg agtgataaca ctgcggccaa cttacttctg acaacgatcg gaggaccgaa

     3121 ggagctaacc gcttttttgc acaacatggg ggatcatgta actcgccttg atcgttggga

     3181 accggagctg aatgaagcca taccaaacga cgagcgtgac accacgatgc ctgtagcaat

     3241 ggcaacaacg ttgcgcaaac tattaactgg cgaactactt actctagctt cccggcaaca

     3301 attaatagac tggatggagg cggataaagt tgcaggacca cttctgcgct cggcccttcc

     3361 ggctggctgg tttattgctg ataaatctgg agccggtgag cgtgggtctc gcggtatcat

     3421 tgcagcactg gggccagatg gtaagccctc ccgtatcgta gttatctaca cgacggggag

     3481 tcaggcaact atggatgaac gaaatagaca gatcgctgag ataggtgcct cactgattaa

     3541 gcattggtaa ctgtcagacc aagtttactc atatatactt tagattgatt taaaacttca

     3601 tttttaattt aaaaggatct aggtgaagat cctttttgat aatctcatga ccaaaatccc

     3661 ttaacgtgag ttttcgttcc actgagcgtc agaccccgta gaaaagatca aaggatcttc

     3721 ttgagatcct ttttttctgc gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc

     3781 agcggtggtt tgtttgccgg atcaagagct accaactctt tttccgaagg taactggctt

     3841 cagcagagcg cagataacca aatactgttc ttctagtgta gccgtagtta ggccaccact

     3901 tcaagaactc tgtagcaccg cctacatacc tcgctctgct aatcctgtta ccagtggctg

     3961 ctgccagtgg cgataagtcg tgtcttaccg ggttggactc aagacgatag ttaccggata

     4021 aggcgcagcg gtcgggctga acggggggtt cgtgcacaca gcccagcttg gagcgaacga

     4081 cctacaccga actgagatac ctacagcgtg agctatgaga aagcgccacg cttcccgaag

     4141 ggagaaaggc ggacaggtat ccggtaagcg gcagggtcgg aacaggagag cgcacgaggg

     4201 agcttccagg gggaaacgcc tggtatcttt atagtcctgt cgggtttcgc cacctctgac

     4261 ttgagcgtcg atttttgtga tgctcgtcag gggggcggag cctatggaaa aacgccagca

     4321 acgcggcctt tttacggttc ctggcctttt gctggccttt tgctcacatg ttctttcctg

     4381 cgttatcccc tgattctgtg gataaccgta ttaccgcctt tgagtgagct gataccgctc

     4441 gccgcagccg aacgaccgag cgcagcgagt cagtgagcga ggaagcggaa gagcgcccaa

     4501 tacgcaaacc gcctctcccc gcgcgttggc cgattcatta atgcagctgg cacgacaggt

     4561 ttcccgactg gaaagcgggc agtgagcgca acgcaattaa tgtgagttag ctcactcatt

     4621 aggcacccca ggctttacac tttatgcttc cggctcgtat gttgtgtgga attgtgagcg

     4681 gataacaatt tcacacagga aacagctatg acatgattac gaattaa

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart