pRK5- HA- Ubiquitin- K48

$160.00

  • Model: PVT10388
  • 50 Units in Stock
Ask a question


Add to Cart:

pRK5-HA-Ubiquitin-K48

Catalog No. PVT10388
Packing 2ug

 

pRK5-HA-Ubiquitin-K48 Information
Function ORF expression plasmid
Alias: 1×Ub
Replicator: PUC
Prokaryotic resistance: amp
Clone strain: DH5 α
Culture condition: 37 ℃

Plasmid host: mammalian cells

Purpose of plasmid: protein expression

Fragment type: gene CDs

Fragment species: Human

Prokaryotic resistance: ampicillin
 

pRK5-HA-Ubiquitin-K48 Sequence

LOCUS       Exported                4996 bp ds-DNA     circular SYN 27-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4996)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 27, 2017

FEATURES             Location/Qualifiers

     source          1..4996

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        14..393

                     /label=CMV enhancer

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        394..597

                     /label=CMV promoter

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     promoter        828..846

                     /label=SP6 promoter

                     /note="promoter for bacteriophage SP6 RNA polymerase"

     regulatory      963..972

                     /regulatory_class="other"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     CDS             975..1001

                     /codon_start=1

                     /product="HA (human influenza hemagglutinin) epitope tag"

                     /label=HA

                     /translation="YPYDVPDYA"

     CDS             1032..1259

                     /codon_start=1

                     /product="human ubiquitin variant containing Lys-48, with 

                     all other lysines mutated to arginine"

                     /label=ubiquitin-K48

                     /translation="MQIFVRTLTGRTITLEVEPSDTIENVRARIQDREGIPPDQQRLIF

                     AGKQLEDGRTLSDYNIQRESTLHLVLRLRGG"

     regulatory      1296..1305

                     /regulatory_class="other"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     polyA_signal    1309..1443

                     /label=SV40 poly(A) signal

                     /note="SV40 polyadenylation signal"

     promoter        1512..1869

                     /label=SV40 promoter

                     /note="SV40 enhancer and early promoter"

     rep_origin      1720..1855

                     /label=SV40 ori

                     /note="SV40 origin of replication"

     rep_origin      2118..2573

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2855..2959

                     /gene="bla"

                     /label=AmpR promoter

     CDS             2960..3820

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      3991..4579

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 ttcgagctcg cccgacattg attattgact agttattaat agtaatcaat tacggggtca

       61 ttagttcata gcccatatat ggagttccgc gttacataac ttacggtaaa tggcccgcct

      121 ggctgaccgc ccaacgaccc ccgcccattg acgtcaataa tgacgtatgt tcccatagta

      181 acgccaatag ggactttcca ttgacgtcaa tgggtggagt atttacggta aactgcccac

      241 ttggcagtac atcaagtgta tcatatgcca agtacgcccc ctattgacgt caatgacggt

      301 aaatggcccg cctggcatta tgcccagtac atgaccttat gggactttcc tacttggcag

      361 tacatctacg tattagtcat cgctattacc atggtgatgc ggttttggca gtacatcaat

      421 gggcgtggat agcggtttga ctcacgggga tttccaagtc tccaccccat tgacgtcaat

      481 gggagtttgt tttggcacca aaatcaacgg gactttccaa aatgtcgtaa caactccgcc

      541 ccattgacgc aaatgggcgg taggcgtgta cggtgggagg tctatataag cagagctcgt

      601 ttagtgaacc gtcagatcgc ctggagacgc catccacgct gttttgacct ccatagaaga

      661 caccgggacc gatccagcct ccgcggccgg gaacggtgca ttggaacgcg gattccccgt

      721 gccaagagtg acgtaagtac cgcctataga gtctataggc ccaccccctt ggcttcgtta

      781 gaacgcggct acaattaata cataacctta tgtatcatac acatacgatt taggtgacac

      841 tatagaataa catccacttt gcctttctct ccacaggtgt ccactcccag gtccaactgc

      901 acctcggttc tatcgattga attcccgaac cgacagtcgg tctcttcacc aaggccattc

      961 gcgccaccat gggctacccc tatgatgtgc ctgactacgc agatctcaat ggtggtggtg

     1021 gtgggtcgac catgcagatc ttcgtcagaa cgttaaccgg tagaaccata actctagaag

     1081 ttgaaccatc cgataccatc gaaaacgtta gagctagaat tcaagacaga gaaggcattc

     1141 cacctgatca acaaagattg atctttgccg gtaagcagct cgaggacggt agaacgctgt

     1201 ctgattacaa cattcagaga gagtccaccc tgcacctggt cctccgtctc agaggtggtt

     1261 gagcggccgc taagtaagta aggatcccca gcttggccgc catggcccaa cttgtttatt

     1321 gcagcttata atggttacaa ataaagcaat agcatcacaa atttcacaaa taaagcattt

     1381 ttttcactgc attctagttg tggtttgtcc aaactcatca atgtatctta tcatgtctgg

     1441 atcgggaatt aattcggcgc agcaccatgg cctgaaataa cctctgaaag aggaacttgg

     1501 ttaggtacct tctgaggcgg aaagaaccag ctgtggaatg tgtgtcagtt agggtgtgga

     1561 aagtccccag gctccccagc aggcagaagt atgcaaagca tgcatctcaa ttagtcagca

     1621 accaggtgtg gaaagtcccc aggctcccca gcaggcagaa gtatgcaaag catgcatctc

     1681 aattagtcag caaccatagt cccgccccta actccgccca tcccgcccct aactccgccc

     1741 agttccgccc attctccgcc ccatggctga ctaatttttt ttatttatgc agaggccgag

     1801 gccgcctcgg cctctgagct attccagaag tagtgaggag gcttttttgg aggcctaggc

     1861 ttttgcaaaa agctgttaac agcttggcac tggccgtcgt tttacaacgt cgtgactggg

     1921 aaaaccctgg cgttacccaa cttaatcgcc ttgcagcaca tccccctttc gccagctggc

     1981 gtaatagcga agaggcccgc accgatcgcc cttcccaaca gttgcgcagc ctgaatggcg

     2041 aatggcgcct gatgcggtat tttctcctta cgcatctgtg cggtatttca caccgcatac

     2101 gtcaaagcaa ccatagtacg cgccctgtag cggcgcatta agcgcggcgg gtgtggtggt

     2161 tacgcgcagc gtgaccgcta cacttgccag cgccctagcg cccgctcctt tcgctttctt

     2221 cccttccttt ctcgccacgt tcgccggctt tccccgtcaa gctctaaatc gggggctccc

     2281 tttagggttc cgatttagtg ctttacggca cctcgacccc aaaaaacttg atttgggtga

     2341 tggttcacgt agtgggccat cgccctgata gacggttttt cgccctttga cgttggagtc

     2401 cacgttcttt aatagtggac tcttgttcca aactggaaca acactcaacc ctatctcggg

     2461 ctattctttt aatttataag ggattttgcc gatttcggcc tattggttaa aaaatgagct

     2521 gatttaacaa aaatttaacg cgaattttaa caaaatatta acgtttacaa ttttatggtg

     2581 cactctcagt acaatctgct ctgatgccgc atagttaagc cagccccgac acccgccaac

     2641 acccgctgac gcgccctgac gggcttgtct gctcccggca tccgcttaca gacaagctgt

     2701 gaccgtctcc gggagctgca tgtgtcagag gttttcaccg tcatcaccga aacgcgcgag

     2761 acgaaagggc ctcgtgatac gcctattttt ataggttaat gtcatgataa taatggtttc

     2821 ttagacgtca ggtggcactt ttcggggaaa tgtgcgcgga acccctattt gtttattttt

     2881 ctaaatacat tcaaatatgt atccgctcat gagacaataa ccctgataaa tgcttcaata

     2941 atattgaaaa aggaagagta tgagtattca acatttccgt gtcgccctta ttcccttttt

     3001 tgcggcattt tgccttcctg tttttgctca cccagaaacg ctggtgaaag taaaagatgc

     3061 tgaagatcag ttgggtgcac gagtgggtta catcgaactg gatctcaaca gcggtaagat

     3121 ccttgagagt tttcgccccg aagaacgttt tccaatgatg agcactttta aagttctgct

     3181 atgtggcgcg gtattatccc gtattgacgc cgggcaagag caactcggtc gccgcataca

     3241 ctattctcag aatgacttgg ttgagtactc accagtcaca gaaaagcatc ttacggatgg

     3301 catgacagta agagaattat gcagtgctgc cataaccatg agtgataaca ctgcggccaa

     3361 cttacttctg acaacgatcg gaggaccgaa ggagctaacc gcttttttgc acaacatggg

     3421 ggatcatgta actcgccttg atcgttggga accggagctg aatgaagcca taccaaacga

     3481 cgagcgtgac accacgatgc ctgtagcaat ggcaacaacg ttgcgcaaac tattaactgg

     3541 cgaactactt actctagctt cccggcaaca attaatagac tggatggagg cggataaagt

     3601 tgcaggacca cttctgcgct cggcccttcc ggctggctgg tttattgctg ataaatctgg

     3661 agccggtgag cgtgggtctc gcggtatcat tgcagcactg gggccagatg gtaagccctc

     3721 ccgtatcgta gttatctaca cgacggggag tcaggcaact atggatgaac gaaatagaca

     3781 gatcgctgag ataggtgcct cactgattaa gcattggtaa ctgtcagacc aagtttactc

     3841 atatatactt tagattgatt taaaacttca tttttaattt aaaaggatct aggtgaagat

     3901 cctttttgat aatctcatga ccaaaatccc ttaacgtgag ttttcgttcc actgagcgtc

     3961 agaccccgta gaaaagatca aaggatcttc ttgagatcct ttttttctgc gcgtaatctg

     4021 ctgcttgcaa acaaaaaaac caccgctacc agcggtggtt tgtttgccgg atcaagagct

     4081 accaactctt tttccgaagg taactggctt cagcagagcg cagataccaa atactgttct

     4141 tctagtgtag ccgtagttag gccaccactt caagaactct gtagcaccgc ctacatacct

     4201 cgctctgcta atcctgttac cagtggctgc tgccagtggc gataagtcgt gtcttaccgg

     4261 gttggactca agacgatagt taccggataa ggcgcagcgg tcgggctgaa cggggggttc

     4321 gtgcacacag cccagcttgg agcgaacgac ctacaccgaa ctgagatacc tacagcgtga

     4381 gctatgagaa agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc cggtaagcgg

     4441 cagggtcgga acaggagagc gcacgaggga gcttccaggg ggaaacgcct ggtatcttta

     4501 tagtcctgtc gggtttcgcc acctctgact tgagcgtcga tttttgtgat gctcgtcagg

     4561 ggggcggagc ctatggaaaa acgccagcaa cgcggccttt ttacggttcc tggccttttg

     4621 ctggcctttt gctcacatgt tctttcctgc gttatcccct gattctgtgg ataaccgtat

     4681 taccgccttt gagtgagctg ataccgctcg ccgcagccga acgaccgagc gcagcgagtc

     4741 agtgagcgag gaagcggaag agcgcccaat acgcaaaccg cctctccccg cgcgttggcc

     4801 gattcattaa tgcagctggc acgacaggtt tcccgactgg aaagcgggca gtgagcgcaa

     4861 cgcaattaat gtgagttagc tcactcatta ggcaccccag gctttacact ttatgcttcc

     4921 ggctcgtatg ttgtgtggaa ttgtgagcgg ataacaattt cacacaggaa acagctatga

     4981 catgattacg aattaa

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart