pRSET- EmGFP Plasmid

$216.00

  • Model: PVT0818
  • 50 Units in Stock
Ask a question


Add to Cart:

pRSET- EmGFP Plasmid

PVT0818   2ug

 

pRSET-EmGFP Information

Promoter: T7

Replicon: pUC ori, F1 ori

Terminator: T7 Terminator

Plasmid Classification: E. coli Vectors; pRSET Series Expressing Plasmids

Plasmid size: 3600bp

Plasmid label: N-His, N-EK, N-Xpress

Prokaryotic resistance: ampicillin Amp

Cloning strain: Escherichia coli DH5alpha

Culture conditions: 37 C, aerobic, LB

Expression host: BL21 (DE3) series, recommended BL21Star (DE3)

Culture conditions: 37 C, aerobic, LB

Induction: IPTG or lactose and its analogues

5'Sequencing Primers: T7 Forward

 

pRSET-EmGFP Description

PRSET-EmGFP is a green fluorescent protein expression plasmid of Escherichia coli.

 

pRSET-EmGFP Sequence

LOCUS       Exported                3600 bp ds-DNA     circular SYN 04-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..3600

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        9..27

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     RBS             59..81

                     /note="efficient ribosome binding site from bacteriophage 

                     T7 gene 10 (Olins and Rangwala, 1989)"

     CDS             101..118

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     CDS             122..154

                     /codon_start=1

                     /product="leader peptide from bacteriophage T7 gene 10"

                     /label=T7 tag

                     /note="promotes efficient translation in E. coli"

                     /translation="MASMTGGQQMG"

     CDS             158..181

                     /codon_start=1

                     /product="Xpress(TM) epitope tag, including an enterokinase

                     recognition and cleavage site"

                     /label=Xpress tag

                     /translation="DLYDDDDK"

     CDS             209..928

                     /codon_start=1

                     /product="Emerald GFP"

                     /label=EmGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHKVYITADKQKNGIK

                     VNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     terminator      1004..1051

                     /label=T7 terminator

                     /note="transcription terminator for bacteriophage T7 RNA 

                     polymerase"

     rep_origin      1148..1603

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        1629..1733

                     /gene="bla"

                     /label=AmpR promoter

     CDS             1734..2594

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      2765..3353

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 cgcgaaatta atacgactca ctatagggag accacaacgg tttccctcta gaaataattt

       61 tgtttaactt taagaaggag atatacatat gcggggttct catcatcatc atcatcatgg

      121 tatggctagc atgactggtg gacagcaaat gggtcgggat ctgtacgacg atgacgataa

      181 ggatcgatgg ggatccgaat tcgccaccat ggtgagcaag ggcgaggagc tgttcaccgg

      241 ggtggtgccc atcctggtcg agctggacgg cgacgtaaac ggccacaagt tcagcgtgtc

      301 cggcgagggc gagggcgatg ccacctacgg caagctgacc ctgaagttca tctgcaccac

      361 cggcaagctg cccgtgccct ggcccaccct cgtgaccacc ttgacctacg gcgtgcagtg

      421 cttcgcccgc taccccgacc acatgaagca gcacgacttc ttcaagtccg ccatgcccga

      481 aggctacgtc caggagcgca ccatcttctt caaggacgac ggcaactaca agacccgcgc

      541 cgaggtgaag ttcgagggcg acaccctggt gaaccgcatc gagctgaagg gcatcgactt

      601 caaggaggac ggcaacatcc tggggcacaa gctggagtac aactacaaca gccacaaggt

      661 ctatatcacc gccgacaagc agaagaacgg catcaaggtg aacttcaaga cccgccacaa

      721 catcgaggac ggcagcgtgc agctcgccga ccactaccag cagaacaccc ccatcggcga

      781 cggccccgtg ctgctgcccg acaaccacta cctgagcacc cagtccgccc tgagcaaaga

      841 ccccaacgag aagcgcgatc acatggtcct gctggagttc gtgaccgccg ccgggatcac

      901 tctcggcatg gacgagctgt acaagtaact cgagaagctt gatccggctg ctaacaaagc

      961 ccgaaaggaa gctgagttgg ctgctgccac cgctgagcaa taactagcat aaccccttgg

     1021 ggcctctaaa cgggtcttga ggggtttttt gctgaaagga ggaactatat ccggatctgg

     1081 cgtaatagcg aagaggcccg caccgatcgc ccttcccaac agttgcgcag cctgaatggc

     1141 gaatgggacg cgccctgtag cggcgcatta agcgcggcgg gtgtggtggt tacgcgcagc

     1201 gtgaccgcta cacttgccag cgccctagcg cccgctcctt tcgctttctt cccttccttt

     1261 ctcgccacgt tcgccggctt tccccgtcaa gctctaaatc gggggctccc tttagggttc

     1321 cgatttagtg ctttacggca cctcgacccc aaaaaacttg attagggtga tggttcacgt

     1381 agtgggccat cgccctgata gacggttttt cgccctttga cgttggagtc cacgttcttt

     1441 aatagtggac tcttgttcca aactggaaca acactcaacc ctatctcggt ctattctttt

     1501 gatttataag ggattttgcc gatttcggcc tattggttaa aaaatgagct gatttaacaa

     1561 aaatttaacg cgaattttaa caaaatatta acgcttacaa tttaggtggc acttttcggg

     1621 gaaatgtgcg cggaacccct atttgtttat ttttctaaat acattcaaat atgtatccgc

     1681 tcatgagaca ataaccctga taaatgcttc aataatattg aaaaaggaag agtatgagta

     1741 ttcaacattt ccgtgtcgcc cttattccct tttttgcggc attttgcctt cctgtttttg

     1801 ctcacccaga aacgctggtg aaagtaaaag atgctgaaga tcagttgggt gcacgagtgg

     1861 gttacatcga actggatctc aacagcggta agatccttga gagttttcgc cccgaagaac

     1921 gttttccaat gatgagcact tttaaagttc tgctatgtgg cgcggtatta tcccgtattg

     1981 acgccgggca agagcaactc ggtcgccgca tacactattc tcagaatgac ttggttgagt

     2041 actcaccagt cacagaaaag catcttacgg atggcatgac agtaagagaa ttatgcagtg

     2101 ctgccataac catgagtgat aacactgcgg ccaacttact tctgacaacg atcggaggac

     2161 cgaaggagct aaccgctttt ttgcacaaca tgggggatca tgtaactcgc cttgatcgtt

     2221 gggaaccgga gctgaatgaa gccataccaa acgacgagcg tgacaccacg atgcctgtag

     2281 caatggcaac aacgttgcgc aaactattaa ctggcgaact acttactcta gcttcccggc

     2341 aacaattaat agactggatg gaggcggata aagttgcagg accacttctg cgctcggccc

     2401 ttccggctgg ctggtttatt gctgataaat ctggagccgg tgagcgtggg tctcgcggta

     2461 tcattgcagc actggggcca gatggtaagc cctcccgtat cgtagttatc tacacgacgg

     2521 ggagtcaggc aactatggat gaacgaaata gacagatcgc tgagataggt gcctcactga

     2581 ttaagcattg gtaactgtca gaccaagttt actcatatat actttagatt gatttaaaac

     2641 ttcattttta atttaaaagg atctaggtga agatcctttt tgataatctc atgaccaaaa

     2701 tcccttaacg tgagttttcg ttccactgag cgtcagaccc cgtagaaaag atcaaaggat

     2761 cttcttgaga tccttttttt ctgcgcgtaa tctgctgctt gcaaacaaaa aaaccaccgc

     2821 taccagcggt ggtttgtttg ccggatcaag agctaccaac tctttttccg aaggtaactg

     2881 gcttcagcag agcgcagata ccaaatactg ttcttctagt gtagccgtag ttaggccacc

     2941 acttcaagaa ctctgtagca ccgcctacat acctcgctct gctaatcctg ttaccagtgg

     3001 ctgctgccag tggcgataag tcgtgtctta ccgggttgga ctcaagacga tagttaccgg

     3061 ataaggcgca gcggtcgggc tgaacggggg gttcgtgcac acagcccagc ttggagcgaa

     3121 cgacctacac cgaactgaga tacctacagc gtgagctatg agaaagcgcc acgcttcccg

     3181 aagggagaaa ggcggacagg tatccggtaa gcggcagggt cggaacagga gagcgcacga

     3241 gggagcttcc agggggaaac gcctggtatc tttatagtcc tgtcgggttt cgccacctct

     3301 gacttgagcg tcgatttttg tgatgctcgt caggggggcg gagcctatgg aaaaacgcca

     3361 gcaacgcggc ctttttacgg ttcctggcct tttgctggcc ttttgctcac atgttctttc

     3421 ctgcgttatc ccctgattct gtggataacc gtattaccgc ctttgagtga gctgataccg

     3481 ctcgccgcag ccgaacgacc gagcgcagcg agtcagtgag cgaggaagcg gaagagcgcc

     3541 caatacgcaa accgcctctc cccgcgcgtt ggccgattca ttaatgcagg atctcgatcc

//

Caution:

Product is for research use only!

Search name

pRSET-EmGFP,Plasmid pRSET-EmGFP,pRSET-EmGFP vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart