pRSV- Rev

$193.00

  • Model: PVT11130
  • 50 Units in Stock
Ask a question


Add to Cart:

pRSV-Rev

Catalog No. PVT11130
Packing 2ug

 

pRSV-Rev Information

Promoter: RSV

Replicator: pUC ori, F1 ori

Plasmid classification: virus series, lentivirus packaging carrier

Plasmid size: 4180bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: M13R:CAGGAAACAGCTATGACC

3'sequencing primers: primers designed according to sequence

 

pRSV-Rev Description

The HIV-1 Rev of the second and third exons added to the Rev cDNA expression plasmid is controlled by the transcription of the RSV U3 promoter. Note that most trono lab lentivirus vectors can only use the second generation packaging system.

pRSV-Rev

 

pRSV-Rev Sequence

LOCUS       Exported                4180 bp ds-DNA     circular SYN 01-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 6

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4180)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Thursday, September 1, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..4180

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      1024..1612

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     protein_bind    1900..1921

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        1936..1966

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    1974..1990

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     primer_bind     1998..2014

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        2159..2420

                     /note="RSV promoter"

                     /note="Rous sarcoma virus enhancer/promoter"

     primer_bind     complement(2983..2999)

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     rep_origin      3331..3786

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        4068..4172

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             4173..853

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

ORIGIN

        1 tcaacatttc cgtgtcgccc ttattccctt ttttgcggca ttttgccttc ctgtttttgc

       61 tcacccagaa acgctggtga aagtaaaaga tgctgaagat cagttgggtg cacgagtggg

      121 ttacatcgaa ctggatctca acagcggtaa gatccttgag agttttcgcc ccgaagaacg

      181 ttttccaatg atgagcactt ttaaagttct gctatgtggc gcggtattat cccgtattga

      241 cgccgggcaa gagcaactcg gtcgccgcat acactattct cagaatgact tggttgagta

      301 ctcaccagtc acagaaaagc atcttacgga tggcatgaca gtaagagaat tatgcagtgc

      361 tgccataacc atgagtgata acactgcggc caacttactt ctgacaacga tcggaggacc

      421 gaaggagcta accgcttttt tgcacaacat gggggatcat gtaactcgcc ttgatcgttg

      481 ggaaccggag ctgaatgaag ccataccaaa cgacgagcgt gacaccacga tgcctgtagc

      541 aatggcaaca acgttgcgca aactattaac tggcgaacta cttactctag cttcccggca

      601 acaattaata gactggatgg aggcggataa agttgcagga ccacttctgc gctcggccct

      661 tccggctggc tggtttattg ctgataaatc tggagccggt gagcgtgggt ctcgcggtat

      721 cattgcagca ctggggccag atggtaagcc ctcccgtatc gtagttatct acacgacggg

      781 gagtcaggca actatggatg aacgaaatag acagatcgct gagataggtg cctcactgat

      841 taagcattgg taactgtcag accaagttta ctcatatata ctttagattg atttaaaact

      901 tcatttttaa tttaaaagga tctaggtgaa gatccttttt gataatctca tgaccaaaat

      961 cccttaacgt gagttttcgt tccactgagc gtcagacccc gtagaaaaga tcaaaggatc

     1021 ttcttgagat cctttttttc tgcgcgtaat ctgctgcttg caaacaaaaa aaccaccgct

     1081 accagcggtg gtttgtttgc cggatcaaga gctaccaact ctttttccga aggtaactgg

     1141 cttcagcaga gcgcagatac caaatactgt tcttctagtg tagccgtagt taggccacca

     1201 cttcaagaac tctgtagcac cgcctacata cctcgctctg ctaatcctgt taccagtggc

     1261 tgctgccagt ggcgataagt cgtgtcttac cgggttggac tcaagacgat agttaccgga

     1321 taaggcgcag cggtcgggct gaacgggggg ttcgtgcaca cagcccagct tggagcgaac

     1381 gacctacacc gaactgagat acctacagcg tgagctatga gaaagcgcca cgcttcccga

     1441 agggagaaag gcggacaggt atccggtaag cggcagggtc ggaacaggag agcgcacgag

     1501 ggagcttcca gggggaaacg cctggtatct ttatagtcct gtcgggtttc gccacctctg

     1561 acttgagcgt cgatttttgt gatgctcgtc aggggggcgg agcctatgga aaaacgccag

     1621 caacgcggcc tttttacggt tcctggcctt ttgctggcct tttgctcaca tgttctttcc

     1681 tgcgttatcc cctgattctg tggataaccg tattaccgcc tttgagtgag ctgataccgc

     1741 tcgccgcagc cgaacgaccg agcgcagcga gtcagtgagc gaggaagcgg aagagcgccc

     1801 aatacgcaaa ccgcctctcc ccgcgcgttg gccgattcat taatgcagct ggcacgacag

     1861 gtttcccgac tggaaagcgg gcagtgagcg caacgcaatt aatgtgagtt agctcactca

     1921 ttaggcaccc caggctttac actttatgct tccggctcgt atgttgtgtg gaattgtgag

     1981 cggataacaa tttcacacag gaaacagcta tgacatgatt acgaattcga tgtacgggcc

     2041 agatatacgc gtatctgagg ggactagggt gtgtttaggc gaaaagcggg gcttcggttg

     2101 tacgcggtta ggagtcccct caggatatag tagtttcgct tttgcatagg gagggggaaa

     2161 tgtagtctta tgcaatactc ttgtagtctt gcaacatggt aacgatgagt tagcaacatg

     2221 ccttacaagg agagaaaaag caccgtgcat gccgattggt ggaagtaagg tggtacgatc

     2281 gtgccttatt aggaaggcaa cagacgggtc tgacatggat tggacgaacc actgaattcc

     2341 gcattgcaga gatattgtat ttaagtgcct agctcgatac aataaacgcc atttgaccat

     2401 tcaccacatt ggtgtgcacc tccaagctcg agctcgttta gtgaaccgtc agatcgcctg

     2461 gagacgccat ccacgctgtt ttgacctcca tagaagacac cgggaccgat ccagcctccc

     2521 ctcgaagcta gtcgattagg catctcctat ggcaggaaga agcggagaca gcgacgaaga

     2581 cctcctcaag gcagtcagac tcatcaagtt tctctatcaa agcaacccac ctcccaatcc

     2641 cgaggggacc cgacaggccc gaaggaatag aagaagaagg tggagagaga gacagagaca

     2701 gatccattcg attagtgaac ggatccttag cacttatctg ggacgatctg cggagcctgt

     2761 gcctcttcag ctaccaccgc ttgagagact tactcttgat tgtaacgagg attgtggaac

     2821 ttctgggacg cagggggtgg gaagccctca aatattggtg gaatctccta caatattgga

     2881 gtcaggagct aaagaatagt gctgttagct tgctcaatgc cacagctata gcagtagctg

     2941 aggggacaga tagggttata gaagtagtac aagaagcttg gcactggccg tcgttttaca

     3001 acgtcgtgat ctgagcctgg gagatctctg gctaactagg gaacccactg cttaagcctc

     3061 aataaagctt gccttgagtg cttcaagtag tgtgtgcccg tctgttgtgt gactctggta

     3121 actagagatc aggaaaaccc tggcgttacc caacttaatc gccttgcagc acatccccct

     3181 ttcgccagct ggcgtaatag cgaagaggcc cgcaccgatc gcccttccca acagttgcgc

     3241 agcctgaatg gcgaatggcg cctgatgcgg tattttctcc ttacgcatct gtgcggtatt

     3301 tcacaccgca tacgtcaaag caaccatagt acgcgccctg tagcggcgca ttaagcgcgg

     3361 cgggtgtggt ggttacgcgc agcgtgaccg ctacacttgc cagcgcccta gcgcccgctc

     3421 ctttcgcttt cttcccttcc tttctcgcca cgttcgccgg ctttccccgt caagctctaa

     3481 atcgggggct ccctttaggg ttccgattta gtgctttacg gcacctcgac cccaaaaaac

     3541 ttgatttggg tgatggttca cgtagtgggc catcgccctg atagacggtt tttcgccctt

     3601 tgacgttgga gtccacgttc tttaatagtg gactcttgtt ccaaactgga acaacactca

     3661 accctatctc gggctattct tttgatttat aagggatttt gccgatttcg gcctattggt

     3721 taaaaaatga gctgatttaa caaaaattta acgcgaattt taacaaaata ttaacgttta

     3781 caattttatg gtgcactctc agtacaatct gctctgatgc cgcatagtta agccagcccc

     3841 gacacccgcc aacacccgct gacgcgccct gacgggcttg tctgctcccg gcatccgctt

     3901 acagacaagc tgtgaccgtc tccgggagct gcatgtgtca gaggttttca ccgtcatcac

     3961 cgaaacgcgc gagacgaaag ggcctcgtga tacgcctatt tttataggtt aatgtcatga

     4021 taataatggt ttcttagacg tcaggtggca cttttcgggg aaatgtgcgc ggaaccccta

     4081 tttgtttatt tttctaaata cattcaaata tgtatccgct catgagacaa taaccctgat

     4141 aaatgcttca ataatattga aaaaggaaga gtatgagtat

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart