pSET152 vector

$265.00

  • Model: PVT3395
  • 50 Units in Stock
Ask a question


Add to Cart:

pSET152 vector

Packing 2ug

 

pSET152 Information

Promoter: No, it needs to be cloned by itself

Prokaryotic Apramycin resistance: Apr

Screening marker: Apramycin Apr

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 30 degrees centigrade

Expression host: Streptomyces, actinomycetes, etc.

 

pSET152 Description

PSET152 is a integrated expression plasmid of Streptomyces. PSET152 vector can integrate exogenous genes into Streptomyces genome, and is a commonly used gene delivery vector for Streptomyces genome to express highly specific genes.

 

pSET152 Sequence

LOCUS       Exported                5715 bp ds-DNA     circular SYN 27-JAN-2018

FEATURES             Location/Qualifiers

     source          1..5715

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(163..507)

                     /codon_start=1

                     /gene="lacZ fragment"

                     /product="LacZ-alpha fragment of beta-galactosidase"

                     /label=lacZ-alpha

                     /translation="MITNSISRAAADPLESTCSPSLALAVVLQRRDWENPGVTQLNRLA

                     AHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRINSPMSSTSGIG

                     SAADAKCRST"

     rep_origin      complement(910..1498)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             1702..2502

                     /codon_start=1

                     /gene="aac(3)IV"

                     /product="aminoglycoside 3-N-acetyltransferase type IV     

                               "

                     /label=Apr

                     /note="confers resistance to apramycin (Paget and Davies, 

                     1996)"

                     /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP

                     LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV

                     KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH

                     LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH

                     AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG"

     CDS             complement(2936..3307)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            3340..3449

                     /note="incP origin of transfer"

     protein_bind    3769..3868

                     /label=phage phi-C31 attP

                     /bound_moiety="phage phi-C31 integrase"

                     /note="attachment site of phage phi-C31"

     CDS             3878..5695

                     /codon_start=1

                     /product="integrase from phage phi-C31"

                     /label=phage phi-C31 integrase

                     /translation="MDTYAGAYDRQSRERENSSAASPATQRSANEDKAADLQREVERDG

                     GRFRFVGHFSEAPGTSAFGTAERPEFERILNECRAGRLNMIIVYDVSRFSRLKVMDAIP

                     IVSELLALGVTIVSTQEGVFRQGNVMDLIHLIMRLDASHKESSLKSAKILDTKNLQREL

                     GGYVGGKAPYGFELVSETKEITRNGRMVNVVINKLAHSTTPLTGPFEFEPDVIRWWWRE

                     IKTHKHLPFKPGSQAAIHPGSITGLCKRMDADAVPTRGETIGKKTASSAWDPATVMRIL

                     RDPRIAGFAAEVIYKKKPDGTPTTKIEGYRIQRDPITLRPVELDCGPIIEPAEWYELQA

                     WLDGRGRGKGLSRGQAILSAMDKLYCECGAVMTSKRGEESIKDSYRCRRRKVVDPSAPG

                     QHEGTCNVSMAALDKFVAERIFNKIRHAEGDEETLALLWEAARRFGKLTEAPEKSGERA

                     NLVAERADALNALEELYEDRAAGAYDGPVGRKHFRKQQAALTLRQQGAEERLAELEAAE

                     APKLPLDQWFPEDADADPTGPKSWWGRASVDDKRVFVGLFVDKIVVTKSTTGRGQGTPI

                     EKRASITWAKPPTDDDEDDAQDGTEDVAA"

ORIGIN

        1 atctacgtct gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca

       61 gctctcgcag ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt

      121 cctgcgggta aatagctgcg ccgatggttt ctacaaagat cgttatgttg atcggcactt

      181 tgcatcggcc gcgctcccga ttccggaagt gcttgacatt ggggaattta tgcggtgtga

      241 aataccgcac agatgcgtaa ggagaaaata ccgcatcagg cgccattcgc cattcaggct

      301 gcgcaactgt tgggaagggc gatcggtgcg ggcctcttcg ctattacgcc agctggcgaa

      361 agggggatgt gctgcaaggc gattaagttg ggtaacgcca gggttttccc agtcacgacg

      421 ttgtaaaacg acggccagtg ccaagcttgg gctgcaggtc gactctagag gatccgcggc

      481 cgcgcgcgat atcgaattcg taatcatgtc atagctgttt cctgtgtgaa attgttatcc

      541 gctcacaatt ccacacaaca tacgagccgg aagcataaag tgtaaagcct ggggtgccta

      601 atgagtgagc taactcacat taattgcgtt gcgctcactg cccgctttcc agtcgggaaa

      661 cctgtcgtgc cagctgcatt aatgaatcgg ccaacgcgcg gggagaggcg gtttgcgtat

      721 tgggcgctct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc ggctgcggcg

      781 agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag gggataacgc

      841 aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt

      901 gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc gacgctcaag

      961 tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc ctggaagctc

     1021 cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg cctttctccc

     1081 ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt cggtgtaggt

     1141 cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc gctgcgcctt

     1201 atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc cactggcagc

     1261 agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag agttcttgaa

     1321 gtggtggcct aactacggct acactagaag aacagtattt ggtatctgcg ctctgctgaa

     1381 gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg

     1441 tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga

     1501 agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact cacgttaagg

     1561 gattttggtc atgagattat caaaaaggat cttcacctag atccttttgg ttcatgtgca

     1621 gctccatcag caaaagggga tgataagttt atcaccaccg actatttgca acagtgccgt

     1681 tgatcgtgct atgatcgact gatgtcatca gcggtggagt gcaatgtcgt gcaatacgaa

     1741 tggcgaaaag ccgagctcat cggtcagctt ctcaaccttg gggttacccc cggcggtgtg

     1801 ctgctggtcc acagctcctt ccgtagcgtc cggcccctcg aagatgggcc acttggactg

     1861 atcgaggccc tgcgtgctgc gctgggtccg ggagggacgc tcgtcatgcc ctcgtggtca

     1921 ggtctggacg acgagccgtt cgatcctgcc acgtcgcccg ttacaccgga ccttggagtt

     1981 gtctctgaca cattctggcg cctgccaaat gtaaagcgca gcgcccatcc atttgccttt

     2041 gcggcagcgg ggccacaggc agagcagatc atctctgatc cattgcccct gccacctcac

     2101 tcgcctgcaa gcccggtcgc ccgtgtccat gaactcgatg ggcaggtact tctcctcggc

     2161 gtgggacacg atgccaacac gacgctgcat cttgccgagt tgatggcaaa ggttccctat

     2221 ggggtgccga gacactgcac cattcttcag gatggcaagt tggtacgcgt cgattatctc

     2281 gagaatgacc actgctgtga gcgctttgcc ttggcggaca ggtggctcaa ggagaagagc

     2341 cttcagaagg aaggtccagt cggtcatgcc tttgctcggt tgatccgctc ccgcgacatt

     2401 gtggcgacag ccctgggtca actgggccga gatccgttga tcttcctgca tccgccagag

     2461 gcgggatgcg aagaatgcga tgccgctcgc cagtcgattg gctgagctca tgagcggaga

     2521 acgagatgac gttggagggg caaggtcgcg ctgattgctg gggcaacacg tggagcggat

     2581 cggggattgt ctttcttcag ctcgctgatg atatgctgac gctcaatgcc gtttggcctc

     2641 cgactaacga aaatcccgca tttggacggc tgatccgatt ggcacggcgg acggcgaatg

     2701 gcggagcaga cgctcgtccg ggggcaatga gatatgaaaa agcctgaact caccgcgacg

     2761 tatcgggccc tggccagcta gctagagtcg acctgcaggt ccccggggat cggtcttgcc

     2821 ttgctcgtcg gtgatgtact tcaccagctc cgcgaagtcg ctcttcttga tggagcgcat

     2881 ggggacgtgc ttggcaatca cgcgcacccc ccggccgttt tagcggctaa aaaagtcatg

     2941 gctctgccct cgggcggacc acgcccatca tgaccttgcc aagctcgtcc tgcttctctt

     3001 cgatcttcgc cagcagggcg aggatcgtgg catcaccgaa ccgcgccgtg cgcgggtcgt

     3061 cggtgagcca gagtttcagc aggccgccca ggcggcccag gtcgccattg atgcgggcca

     3121 gctcgcggac gtgctcatag tccacgacgc ccgtgatttt gtagccctgg ccgacggcca

     3181 gcaggtaggc cgacaggctc atgccggccg ccgccgcctt ttcctcaatc gctcttcgtt

     3241 cgtctggaag gcagtacacc ttgataggtg ggctgccctt cctggttggc ttggtttcat

     3301 cagccatccg cttgccctca tctgttacgc cggcggtagc cggccagcct cgcagagcag

     3361 gattcccgtt gagcaccgcc aggtgcgaat aagggacagt gaagaaggaa cacccgctcg

     3421 cgggtgggcc tacttcacct atcctgcccg gctgacgccg ttggatacac caaggaaagt

     3481 ctacacgaac cctttggcaa aatcctgtat atcgtgcgaa aaaggatgga tataccgaaa

     3541 aaatcgctat aatgaccccg aagcagggtt atgcagcgga aaagatccgt cgacctgcag

     3601 gcatgcaagc tctagcgatt ccagacgtcc cgaaggcgtg gcgcggcttc cccgtgccgg

     3661 agcaatcgcc ctgggtgggt tacacgacgc ccctctatgg cccgtactga cggacacacc

     3721 gaagccccgg cggcaaccct cagcggatgc cccggggctt cacgttttcc caggtcagaa

     3781 gcggttttcg ggagtagtgc cccaactggg gtaacctttg agttctctca gttgggggcg

     3841 tagggtcgcc gacatgacac aaggggttgt gaccggggtg gacacgtacg cgggtgctta

     3901 cgaccgtcag tcgcgcgagc gcgagaattc gagcgcagca agcccagcga cacagcgtag

     3961 cgccaacgaa gacaaggcgg ccgaccttca gcgcgaagtc gagcgcgacg ggggccggtt

     4021 caggttcgtc gggcatttca gcgaagcgcc gggcacgtcg gcgttcggga cggcggagcg

     4081 cccggagttc gaacgcatcc tgaacgaatg ccgcgccggg cggctcaaca tgatcattgt

     4141 ctatgacgtg tcgcgcttct cgcgcctgaa ggtcatggac gcgattccga ttgtctcgga

     4201 attgctcgcc ctgggcgtga cgattgtttc cactcaggaa ggcgtcttcc ggcagggaaa

     4261 cgtcatggac ctgattcacc tgattatgcg gctcgacgcg tcgcacaaag aatcttcgct

     4321 gaagtcggcg aagattctcg acacgaagaa ccttcagcgc gaattgggcg ggtacgtcgg

     4381 cgggaaggcg ccttacggct tcgagcttgt ttcggagacg aaggagatca cgcgcaacgg

     4441 ccgaatggtc aatgtcgtca tcaacaagct tgcgcactcg accactcccc ttaccggacc

     4501 cttcgagttc gagcccgacg taatccggtg gtggtggcgt gagatcaaga cgcacaaaca

     4561 ccttcccttc aagccgggca gtcaagccgc cattcacccg ggcagcatca cggggctttg

     4621 taagcgcatg gacgctgacg ccgtgccgac ccggggcgag acgattggga agaagaccgc

     4681 ttcaagcgcc tgggacccgg caaccgttat gcgaatcctt cgggacccgc gtattgcggg

     4741 cttcgccgct gaggtgatct acaagaagaa gccggacggc acgccgacca cgaagattga

     4801 gggttaccgc attcagcgcg acccgatcac gctccggccg gtcgagcttg attgcggacc

     4861 gatcatcgag cccgctgagt ggtatgagct tcaggcgtgg ttggacggca gggggcgcgg

     4921 caaggggctt tcccgggggc aagccattct gtccgccatg gacaagctgt actgcgagtg

     4981 tggcgccgtc atgacttcga agcgcgggga agaatcgatc aaggactctt accgctgccg

     5041 tcgccggaag gtggtcgacc cgtccgcacc tgggcagcac gaaggcacgt gcaacgtcag

     5101 catggcggca ctcgacaagt tcgttgcgga acgcatcttc aacaagatca ggcacgccga

     5161 aggcgacgaa gagacgttgg cgcttctgtg ggaagccgcc cgacgcttcg gcaagctcac

     5221 tgaggcgcct gagaagagcg gcgaacgggc gaaccttgtt gcggagcgcg ccgacgccct

     5281 gaacgccctt gaagagctgt acgaagaccg cgcggcaggc gcgtacgacg gacccgttgg

     5341 caggaagcac ttccggaagc aacaggcagc gctgacgctc cggcagcaag gggcggaaga

     5401 gcggcttgcc gaacttgaag ccgccgaagc cccgaagctt ccccttgacc aatggttccc

     5461 cgaagacgcc gacgctgacc cgaccggccc taagtcgtgg tgggggcgcg cgtcagtaga

     5521 cgacaagcgc gtgttcgtcg ggctcttcgt agacaagatc gttgtcacga agtcgactac

     5581 gggcaggggg cagggaacgc ccatcgagaa gcgcgcttcg atcacgtggg cgaagccgcc

     5641 gaccgacgac gacgaagacg acgcccagga cggcacggaa gacgtagcgg cgtagcgaga

     5701 cacccgggaa gcctg

//

 

Caution:
Product is for research use only!

 

 

Alternative name

pSET152 vector,pSET152, vector pSET152, pSET152 Plasmid, Plasmid pSET152

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart