pSET4S

$260.00

  • Model: PVT11372
  • 49 Units in Stock
Ask a question


Add to Cart:

pSET4S


PVT11372    2ug
 

pSET4S Description

PSET4S is a Streptomyces gene knockout plasmid.

 

pSET4S Sequence

 

LOCUS       Exported                4506 bp ds-DNA     circular SYN 06-SEP-2016
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..4506
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             complement(133..144)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /note="Factor Xa site"
                     /translation="IEGR"
     CDS             756..1454
                     /codon_start=1
                     /note="RepA"
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     CDS             complement(1803..2126)
                     /codon_start=1
                     /gene="lacZ fragment"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /note="lacZ-alpha"
                     /translation="MTMITPSLHACRSTLEDPRVPSSNSLAVVLQRRDWENPGVTQLNR
                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRIWCTLSTICS
                     DAA"
     primer_bind     2036..2052
                     /note="M13 fwd"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    2053..2109
                     /note="MCS"
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(2122..2138)
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    2146..2162
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2170..2200)
                     /note="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    2215..2236
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding site"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(2524..3112)
                     /direction=LEFT
                     /note="ColE1 ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             3730..4404
                     /codon_start=1
                     /note="Spe"
                     /translation="MFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI
                     GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLY
                     QAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILT
                     MDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLK
                     KL"
ORIGIN
        1 actagttatc ggcataatcg ttaaaacagg cgttatcgta gcgtaaaagc ccttgagcgt
       61 agcgtggctt tgcagcgaag atgttgtctg ttagattatg aaagccgatg actgaatgaa
      121 ataataagcg cagcgccctt ctatttcggt tggaggaggc tcaagggagt atgagggaat
      181 gaaattccct catgggtttg attttaaaaa ttgcttgcaa ttttgccgag cggtagcgct
      241 ggaaaatttt tgaaaaaaat ttggaatttg gaaaaaaatg gggggaaagg aagcgaattt
      301 tgcttccgta ctacgacccc ccattaagtg ccgagtgcca atttttgtgc caaaaacgct
      361 ctatcccaac tggctcaagg gtttaagggg tttttcaatc gccaacgaat cgccaacgtt
      421 ttcgccaacg ttttttataa atctatattt aagtagcttt attgttgttt ttatgattac
      481 aaagtgatac actaacttta taaaattatt tgattggagt tttttaaatg gtgatttcag
      541 aatcgaaaaa aagagttatg atttctctga caaaagagca agataaaaaa ttaacagata
      601 tggcgaaaca aaaaggtttt tcaaaatctg cggttgcggc gttagctata gaagaatatg
      661 caagaaagga atcagaacaa aaaaaataag cgaaagctcg cgtttttaga aggatacgag
      721 ttttcgctac ttgtttttga taaggtaatt atatcatggc tattaaaaat actaaagcta
      781 gaaattttgg atttttatta tatcctgact caattcctaa tgattggaaa gaaaaattag
      841 agagtttggg cgtatctatg gctgtcagtc ctttacacga tatggacgaa aaaaaagata
      901 aagatacatg gaataatagt aatattatac aaaatggaaa gcactataaa aaaccacact
      961 atcacgttat atatattgca cgaaatcctg taacaataga aagcgttagg aacaagatta
     1021 agcgaaaatt ggggaatagt tcagttgctc atgttgagat acttgattat atcaaaggtt
     1081 catatgaata tttgactcat gaatcaaagg acgctattgc taagaataaa catatatacg
     1141 acaaaaaaga tattttgaac attaatgatt ttgatattga ccgctatata acacttgatg
     1201 aaagccaaaa aagagaattg aagaatttac ttttagatat agtggatgac tataatttgg
     1261 taaatacaaa agatttaatg gcttttattc gccttagggg agcggagttt ggaattttaa
     1321 atacgaatga tgtaaaagat attgtttcaa caaactctag cgcctttaga ttatggtttg
     1381 agggcaatta tcagtgtgga tatagagcaa gttatgcaaa ggttcttgat gctgaaacgg
     1441 gggaaataaa atgacaaaca aagaaaaaga gttatttgct gaaaatgagg aattaaaaaa
     1501 agaaattaag gacttaaaag agcgtattga aagatacaga gaaatggaag ttgaattaag
     1561 tacaacaata gatttattga gaggagggat tattgaataa ataaaagccc cctgacgaaa
     1621 gtcgaagggg gtttttattt tggtttgatg ttgcgattaa tagatctcgg tgatgacggt
     1681 gaaaacctct gacacatgca gctcccggag acggtcacag cttgtctgta agcggatgcc
     1741 gggagcagac aagcccgtca gggcgcgtca gcgggtgttg gcgggtgtcg gggctggctt
     1801 aactatgcgg catcagagca gattgtactg agagtgcacc atatgcggtg tgaaataccg
     1861 cacagatgcg taaggagaaa ataccgcatc aggcgccatt cgccattcag gctgcgcaac
     1921 tgttgggaag ggcgatcggt gcgggcctct tcgctattac gccagctggc gaaaggggga
     1981 tgtgctgcaa ggcgattaag ttgggtaacg ccagggtttt cccagtcacg acgttgtaaa
     2041 acgacggcca gtgaattcga gctcggtacc cggggatcct ctagagtcga cctgcaggca
     2101 tgcaagcttg gcgtaatcat ggtcatagct gtttcctgtg tgaaattgtt atccgctcac
     2161 aattccacac aacatacgag ccggaagcat aaagtgtaaa gcctggggtg cctaatgagt
     2221 gagctaactc acattaattg cgttgcgctc actgcccgct ttccagtcgg gaaacctgtc
     2281 gtgccagctg cattaatgaa tcggccaacg cgcggggaga ggcggtttgc gtattgggcg
     2341 ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc ggcgagcggt
<
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart