pSilencer 1.0- U6

$193.00

  • Model: PVT10866
  • 50 Units in Stock
Ask a question


Add to Cart:

pSilencer 1.0-U6

Catalog No. PVT10866
Packing 2ug

 

pSilencer 1.0-U6 Information

Function Mammal Editing plasmids

Promoter: U6

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 degrees centigrade

 

pSilencer 1.0-U6 Description

PSilencer 1.0-U6 is a lactating RNA expression plasmid.

pSilencer-1.0-U6-vector

 

pSilencer 1.0-U6 Sequence
 

LOCUS       Exported                3292 bp ds-DNA     circular SYN 20-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..3292

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      complement(3..458)

                     /direction=LEFT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        675..988

                     /label=U6 promoter

                     /note="RNA polymerase III promoter for mouse U6 snRNA (Das 

                     et al., 1988)"

     misc_feature    990..1091

                     /label=MCS

     rep_origin      complement(1545..2133)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(2304..3164)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(3165..3269)

                     /gene="bla"

                     /label=AmpR promoter

ORIGIN

        1 ctaaattgta agcgttaata ttttgttaaa attcgcgtta aatttttgtt aaatcagctc

       61 attttttaac caataggccg aaatcggcaa aatcccttat aaatcaaaag aatagaccga

      121 gatagggttg agtgttgttc cagtttggaa caagagtcca ctattaaaga acgtggactc

      181 caacgtcaaa gggcgaaaaa ccgtctatca gggcgatggc ccactacgtg aaccatcacc

      241 ctaatcaagt tttttggggt cgaggtgccg taaagcacta aatcggaacc ctaaagggag

      301 cccccgattt agagcttgac ggggaaagcc ggcgaacgtg gcgagaaagg aagggaagaa

      361 agcgaaagga gcgggcgcta gggcgctggc aagtgtagcg gtcacgctgc gcgtaaccac

      421 cacacccgcc gcgcttaatg cgccgctaca gggcgcgtcc cattcgccat tcaggctgcg

      481 caactgttgg gaagggcgat cggtgcgggc ctcttcgcta ttacgccagc tggcgaaagg

      541 gggatgtgct gcaaggcgat taagttgggt aacgccaggg ttttcccagt cacgacgttg

      601 taaaacgacg gccagtgagc gcgcgtaata cgactcacta tagggcgaat tgggtacccg

      661 ctctagaact agtggatccg acgccgccat ctctaggccc gcgccggccc cctcgcacag

      721 acttgtggga gaagctcggc tactcccctg ccccggttaa tttgcatata atatttccta

      781 gtaactatag aggcttaatg tgcgataaaa gacagataat ctgttctttt taatactagc

      841 tacattttac atgataggct tggatttcta taagagatac aaatactaaa ttattatttt

      901 aaaaaacagc acaaaaggaa actcacccta actgtaaagt aattgtgtgt tttgagacta

      961 taaatatccc ttggagaaaa gccttgtttg ggccccccct cgaggtcgac ggtatcgata

     1021 agcttgatat cgaattcctg cagcccgggg gatccactag ttctagagcg gccgccaccg

     1081 cggtggagct ccagcttttg ttccctttag tgagggttaa ttgcgcgctt ggcgtaatca

     1141 tggtcatagc tgtttcctgt gtgaaattgt tatccgctca caattccaca caacatacga

     1201 gccggaagca taaagtgtaa agcctggggt gcctaatgag tgagctaact cacattaatt

     1261 gcgttgcgct cactgcccgc tttccagtcg ggaaacctgt cgtgccagct gcattaatga

     1321 atcggccaac gcgcggggag aggcggtttg cgtattgggc gctcttccgc ttcctcgctc

     1381 actgactcgc tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg

     1441 gtaatacggt tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc

     1501 cagcaaaagg ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc

     1561 ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga

     1621 ctataaagat accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc

     1681 ctgccgctta ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat

     1741 agctcacgct gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg

     1801 cacgaacccc ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc

     1861 aacccggtaa gacacgactt atcgccactg gcagcagcca ctggtaacag gattagcaga

     1921 gcgaggtatg taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact

     1981 agaagaacag tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt

     2041 ggtagctctt gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag

     2101 cagcagatta cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg

     2161 tctgacgctc agtggaacga aaactcacgt taagggattt tggtcatgag attatcaaaa

     2221 aggannttca cctagatcct tttaaattaa aaatgaagtt ttaaatcaat ctaaagtata

     2281 tatgagtaaa cttggtctga cagttaccaa tgcttaatca gtgaggcacc tatctcagcg

     2341 atctgtctat ttcgttcatc catagttgcc tgactccccg tcgtgtagat aactacgata

     2401 cgggagggct taccatctgg ccccagtgct gcaatgatac cgcgagaccc acgctcaccg

     2461 gctccagatt tatcagcaat aaaccagcca gccggaaggg ccgagcgcag aagtggtcct

     2521 gcaactttat ccgcctccat ccagtctatt aattgttgcc gggaagctag agtaagtagt

     2581 tcgccagtta atagtttgcg caacgttgtt gccattgcta caggcatcgt ggtgtcacgc

     2641 tcgtcgtttg gtatggcttc attcagctcc ggttcccaac gatcaaggcg agttacatga

     2701 tcccccatgt tgtgcaaaaa agcggttagc tccttcggtc ctccgatcgt tgtcagaagt

     2761 aagttggccg cagtgttatc actcatggtt atggcagcac tgcataattc tcttactgtc

     2821 atgccatccg taagatgctt ttctgtgact ggtgagtact caaccaagtc attctgagaa

     2881 tagtgtatgc ggcgaccgag ttgctcttgc ccggcgtcaa tacgggataa taccgcgcca

     2941 catagcagaa ctttaaaagt gctcatcatt ggaaaacgtt cttcggggcg aaaactctca

     3001 aggatcttac cgctgttgag atccagttcg atgtaaccca ctcgtgcacc caactgatct

     3061 tcagcatctt ttactttcac cagcgtttct gggtgagcaa aaacaggaag gcaaaatgcc

     3121 gcaaaaaagg gaataagggc gacacggaaa tgttgaatac tcatactctt cctttttcaa

     3181 tattattgaa gcatttatca gggttattgt ctcatgagcg gatacatatt tgaatgtatt

     3241 tagaaaaata aacaaatagg ggttccgcgc acatttcccc gaaaagtgcc ac

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart