pSoup

$260.00

  • Model: PVT11189
  • 50 Units in Stock
Ask a question


Add to Cart:

pSoup


Catalog No. PVT11189
Packing 2ug

 

pSoup Informaiton

Replicon: pVS1 oriV, ori

Plasmid classification: plant series, protein overexpression vector

Prokaryotic resistance: Tet

Clonal strain: DH5 alpha

Culture conditions: 37 C, aerobic, LB

Expression host: plant cells

Primers for 5'sequencing: primers designed based on sequences

Primers for 3'sequencing: primers designed based on sequences

 

pSoup Sequence

LOCUS       Exported                9275 bp ds-DNA     circular SYN 26-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..9275

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     oriT            618..727

                     /note="incP origin of transfer"

     CDS             760..1131

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     rep_origin      1258..1969

                     /label=oriV

                     /note="incP origin of replication"

     promoter        complement(2505..2523)

                     /label=SP6 promoter

                     /note="promoter for bacteriophage SP6 RNA polymerase"

     primer_bind     complement(2541..2557)

                     /label=M13 rev

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    2565..2581

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(2589..2619)

                     /label=lac promoter

                     /note="promoter for the E. coli lac operon"

     protein_bind    2634..2655

                     /label=CAP binding site

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     promoter        2902..2930

                     /label=tet promoter

                     /note="E. coli promoter for tetracycline efflux protein 

                     gene"

     CDS             2978..4168

                     /codon_start=1

                     /gene="tet"

                     /product="tetracycline efflux protein"

                     /label=TcR

                     /note="confers resistance to tetracycline"

                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY

                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI

                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF

                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM

                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII

                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL

                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"

     CDS             4667..5815

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /label=trfA

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             7196..8167

                     /codon_start=1

                     /gene="repA"

                     /product="replication protein of plasmid pSa"

                     /label=RepA

                     /translation="MPKNNKAPGHRINEIIKTSLALEMEDAREAGLVGYMARCLVQATM

                     PHTDPKTSYFERTNGIVTLSIMGKPSIGLPYGSMPRTLLAWICTEAVRTKDPVLNLGRS

                     QSEFLQRLGMHTDGRYTATLRNQAQRLFSSMISLAGEQGNDFGIENVVIAKRAFLFWNP

                     KRPEDRALWDSTLTLTGDFFEEVTRSPVPIRIDYLHALRQSPLAMDIYTWLTYRVFLLR

                     AKGRPFVQIPWVALQAQFGSSYGSRARNSPELDDKARERAERAALASFKYNFKKRLREV

                     LIVYPEASDCIEDDGECLRIKSTRLHVTRAPGKGARIGPPPT"

     CDS             8562..9212

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /label=TetR

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

ORIGIN

        1 cccctttcca ccgcgtcaga cgcccgtagc agcccgctac gggctttttc atgccctgcc

       61 ctagcgtcca agcctcacgg ccgcgctcgg cctctctggc ggccttctgg cgctcttccg

      121 cttcctcgct cactgactcg ctgcgctcgg tcgttcggct gcggcgagcg gtatcagctc

      181 actcaaaggc ggtaatacgg ttatccacag aatcagggga taacgcagga aagaacatgt

      241 gagcaaaagg ccagcaaaag gccaggaacc gtaaaaaggc cgcgttgctg gcgtttttcc

      301 ataggctccg cccccctgac gagcatcaca aaaatcgacg ctcaagtcag aggtggcgaa

      361 acccgacagg actataaaga taccaggcgt ttccccctgg aagctccctc gtgcgctctc

      421 ctgttccgac cctgccgctt accggatacc tgtccgcctt tctcccttcg ggaagcgtgg

      481 cgcttttccg ctgcataacc ctgcttcggg gtcattatag cgattttttc ggtatatcca

      541 tcctttttcg cacgatatac aggattttgc caaagggttc gtgtagactt tccttggtgt

      601 atccaacggc gtcagccggg caggataggt gaagtaggcc cacccgcgag cgggtgttcc

      661 ttcttcactg tcccttattc gcacctggcg gtgctcaacg ggaatcctgc tctgcgaggc

      721 tggccggcta ccgccggcgt aacagatgag ggcaagcgga tggctgatga aaccaagcca

      781 accaggaagg gcagcccacc tatcaaggtg tactgccttc cagacgaacg aagagcgatt

      841 gaggaaaagg cggcggcggc cggcatgagc ctgtcggcct acctgctggc cgtcggccag

      901 ggctacaaaa tcacgggcgt cgtggactat gagcacgtcc gcgagctggc ccgcatcaat

      961 ggcgacctgg gccgcctggg cggcctgctg aaactctggc tcaccgacga cccgcgcacg

     1021 gcgcggttcg gtgatgccac gatcctcgcc ctgctggcga agatcgaaga gaagcaggac

     1081 gagcttggca aggtcatgat gggcgtggtc cgcccgaggg cagagccatg acttttttag

     1141 ccgctaaaac ggccgggggg tgcgcgtgat tgccaagcac gtccccatgc gctccatcaa

     1201 gaagagcgac ttcgcggagc tggtgaagta catcaccgac gagcaaggca agaccgagcg

     1261 cctttgcgac gctcaccggg ctggttgccc tcgccgctgg gctggcggcc gtctatggcc

     1321 ctgcaaacgc gccagaaacg ccgtcgaagc cgtgtgcgag acaccgcggc cgccggcgtt

     1381 gtggatacct cgcggaaaac ttggccctca ctgacagatg aggggcggac gttgacactt

     1441 gaggggccga ctcacccggc gcggcgttga cagatgaggg gcaggctcga tttcggccgg

     1501 cgacgtggag ctggccagcc tcgcaaatcg gcgaaaacgc ctgattttac gcgagtttcc

     1561 cacagatgat gtggacaagc ctggggataa gtgccctgcg gtattgacac ttgaggggcg

     1621 cgactactga cagatgaggg gcgcgatcct tgacacttga ggggcagagt gctgacagat

     1681 gaggggcgca cctattgaca tttgaggggc tgtccacagg cagaaaatcc agcatttgca

     1741 agggtttccg cccgtttttc ggccaccgct aacctgtctt ttaacctgct tttaaaccaa

     1801 tatttataaa ccttgttttt aaccagggct gcgccctgtg cgcgtgaccg cgcacgccga

     1861 aggggggtgc ccccccttct cgaaccctcc cggcccgcta acgcgggcct cccatccccc

     1921 caggggctgc gcccctcggc cgcgaacggc ctcaccccaa aaatggcagc gctggcagtc

     1981 cttgccattg ccgggatcgg ggcagtaacg ggatgggcga tcagcccgag cgcgacgccc

     2041 ggaagcattg acgtgccgca ggtgctggca tcgacattca gcgaccaggt gccgggcagt

     2101 gagggcggcg gcctgggtgg cggcctgccc ttcacttcgg ccgtcggggc attcacggac

     2161 ttcatggcgg ggccggcaat ttttaccttg ggcattcttg gcatagtggt cgcgggtgcc

     2221 gtgctcgtgt tcgggggtgc gataaaccca gcgaaccatt tgaggtgata ggtaagatta

     2281 taccgaggta tgaaaacgag aattggacct ttacagaatt actctatgaa gcgccatatt

     2341 taaaaagcta ccaagacgaa gaggatgaag aggatgagga ggcagattgc cttgaatata

     2401 ttgacaatac tgataagata atatatcttt tatatagaag ataattcgag ctcggtaccc

     2461 ggggatcctc tagagtcgac ctgcaggcat gcaagcttga gtattctata gtgtcaccta

     2521 aatagcttgg cgtaatcatg gtcatagctg tttcctgtgt gaaattgtta tccgctcaca

     2581 attccacaca acatacgagc cggaagcata aagtgtaaag cctggggtgc ctaatgagtg

     2641 agctaactca cattaattgc gttgcgctca ctgcccgctt tccagtcggg aaacctgtcg

     2701 tgccagctgc attaatgaat cggccaacgc gcggggagag gcggtttgcg tattgggcgc

     2761 tcttccgctt cctcgctcac tgactcgctg cgctcggtcg ttcggctgcg gcgagcggta

     2821 tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa cgcaggaaag

     2881 aacatgaatt aattctcatg tttgacagct tatcatcgat tagctttaat gcggtagttt

     2941 atcacagtta aattgctaac gcagtcaggc accgtgtatg aaatctaaca atgcgctcat

     3001 cgtcatcctc ggcaccgtca ccctggatgc tgtaggcata ggcttggtta tgccggtact

     3061 gccgggcctc ttgcgggata tcgtccattc cgacagcatc gccagtcact atggcgtgct

     3121 gctagcgcta tatgcgttga tgcaatttct atgcgcaccc gttctcggag cactgtccga

     3181 ccgctttggc cgccgcccag tcctgctcgc ttcgctactt ggagccacta tcgactacgc

     3241 gatcatggcg accacacccg tcctgtggat tctctacgcc ggacgcatcg tggccggcat

     3301 caccggcgcc acaggtgcgg ttgctggcgc ctatatcgcc gacatcaccg atggggaaga

     3361 tcgggctcgc cacttcgggc tcatgagcgc ttgtttcggc gtgggtatgg tggcaggccc

     3421 cgtggccggg ggactgttgg gcgccatctc cttacatgca ccattccttg cggcggcggt

     3481 gctcaacggc ctcaacctac tactgggctg cttcctaatg caggagtcgc ataagggaga

     3541 gcgccgaccg atgcccttga gagccttcaa cccagtcagc tccttccggt gggcgcgggg

     3601 catgactatc gtcgccgcac ttatgactgt cttctttatc atgcaactcg taggacaggt

     3661 gccggcagcg ctctgggtca ttttcggcga ggaccgcttt cgctggagcg cgacgatgat

     3721 cggcctgtcg cttgcggtat tcggaatctt gcacgccctc gctcaagcct tcgtcactgg

     3781 tcccgccacc aaacgtttcg gcgagaagca ggccattatc gccggcatgg cggccgacgc

     3841 gctgggctac gtcttgctgg cgttcgcgac gcgaggctgg atggccttcc ccattatgat

     3901 tcttctcgct tccggcggca tcgggatgcc cgcgttgcag gccatgctgt ccaggcaggt

     3961 agatgacgac catcagggac agcttcaagg atcgctcgcg gctcttacca gcctaacttc

     4021 gatcactgga ccgctgatcg tcacggcgat ttatgccgcc tcggcgagca catggaacgg

     4081 gttggcatgg attgtaggcg ccgccctata ccttgtctgc ctccccgcgt tgcgtcgcgg

     4141 tgcatggagc cgggccacct cgacctgaat ggaagccggc ggcacctcgc taacggattc

     4201 accactccaa gaattggagc caatcaattc ttgcggagaa ctgtgaatgc gcaaaccaac

     4261 ccttgtatcg gggaagaaca gtatgtcgag ctattttttg acttactggg gatcaagcct

     4321 gattgggaga aaataaaata ttatatttta ctggatgaat tgttttagta cctagatgtg

     4381 gcgcaacgat gccggcgaca agcaggagcg caccgacttc ttccgcatca agtgttttgg

     4441 ctctcaggcc gaggcccacg gcaagtattt gggcaagggg tcgctggtat tcgtgcaggg

     4501 caagattcgg aataccaagt acgagaagga cggccagacg gtctacggga ccgacttcat

     4561 tgccgataag gtggattatc tggacaccaa ggcaccaggc gggtcaaatc aggaataagg

     4621 gcacattgcc ccggcgtgag tcggggcaat cccgcaagga gggtgaatga atcggacgtt

     4681 tgaccggaag gcatacaggc aagaactgat cgacgcgggg ttttccgccg aggatgccga

     4741 aaccatcgca agccgcaccg tcatgcgtgc gccccgcgaa accttccagt ccgtcggctc

     4801 gatggtccag caagctacgg ccaagatcga gcgcgacagc gtgcaactgg ctccccctgc

     4861 cctgcccgcg ccatcggccg ccgtggagcg ttcgcgtcgt ctcgaacagg aggcggcagg

     4921 tttggcgaag tcgatgacca tcgacacgcg aggaactatg acgaccaaga agcgaaaaac

     4981 cgccggcgag gacctggcaa aacaggtcag cgaggccaag caggccgcgt tgctgaaaca

     5041 cacgaagcag cagatcaagg aaatgcagct ttccttgttc gatattgcgc cgtggccgga

     5101 cacgatgcga gcgatgccaa acgacacggc ccgctctgcc ctgttcacca cgcgcaacaa

     5161 gaaaatcccg cgcgaggcgc tgcaaaacaa ggtcattttc cacgtcaaca aggacgtgaa

     5221 gatcacctac accggcgtcg agctgcgggc cgacgatgac gaactggtgt ggcagcaggt

     5281 gttggagtac gcgaagcgca cccctatcgg cgagccgatc accttcacgt tctacgagct

     5341 ttgccaggac ctgggctggt cgatcaatgg ccggtattac acgaaggccg aggaatgcct

     5401 gtcgcgccta caggcgacgg cgatgggctt cacgtccgac cgcgttgggc acctggaatc

     5461 ggtgtcgctg ctgcaccgct tccgcgtcct ggaccgtggc aagaaaacgt cccgttgcca

     5521 ggtcctgatc gacgaggaaa tcgtcgtgct gtttgctggc gaccactaca cgaaattcat

     5581 atgggagaag taccgcaagc tgtcgccgac ggcccgacgg atgttcgact atttcagctc

     5641 gcaccgggag ccgtacccgc tcaagctgga aaccttccgc ctcatgtgcg gatcggattc

     5701 cacccgcgtg aagaagtggc gcgagcaggt cggcgaagcc tgcgaagagt tgcgaggcag

     5761 cggcctggtg gaacacgcct gggtcaatga tgacctggtg cattgcaaac gctagggcct

     5821 tgtggggtca gttccggctg ggggttcagc agccagcgct ttactggcat ttcaggaaca

     5881 agcgggcact gctcgacgca cttgcttcgc tcagtatcgc tcgggacgca cggcgcgctc

     5941 tacgaactgc cgataaacag aggattaaaa ttgacaattg tgattaaggc tcagattcga

     6001 cggcttggag cggccgacgt gcaggatttc cgcgagatcc gattgtcggc cctgaagaaa

     6061 gctccagaga tgttcgggtc cgtttacgag cacgaggaga aaaagcccat ggaggcgttc

     6121 gctgaacggt tgcgagatgc cgtggcattc ggcgcctaca tcgacggcga gatcattggg

     6181 ctgtcggtct tcaaacagga ggacggcccc aaggacgctc acaaggcgca tctgtccggc

     6241 gttttcgtgg agcccgaaca gcgaggccga ggggtcgccg gtatgctgct gcgggcgttg

     6301 ccggcgggtt tattgctcgt gatgatcgtc cgacagattc caacgggaat ctggtggatg

     6361 cgcatcttca tcctcggcgc acttaatatt tcgctattct ggagcttgtt gtttatttcg

     6421 gtctaccgcc tgccgggcgg ggtcgcggcg acggtaggcg ctgtgcagcc gctgatggtc

     6481 gtgttcatct ctgccgctct gctaggtagc ccgatacgat tgatggcggt cctgggggct

     6541 atttgcggaa ctgcgggcgt ggcgctgttg gtgttgacac caaacgcagc gctagatcct

     6601 gtcggcgtcg cagcgggcct ggcgggggcg gtttccatgg cgttcggaac cgtgctgacc

     6661 cgcaagtggc aacctcccgt gcctctgctc acctttaccg cctggcaact ggcggccgga

     6721 ggacttctgc tcgttccagt agctttagtg tttgatccgc caatcccgat gcctacagga

     6781 accaatgttc tcggcctggc gtggctcggc ctgatcggag cgggtttaac ctacttcctt

     6841 tggttccggg ggatctcgcg actcgaacct acagttgttt ccttactggg ctttctcagc

     6901 cccagatcct agaggatcga gcggcatttc attcaggcac gtaccaccga ggcgctacaa

     6961 gtcgccagag agcgcggcaa gacgctcggg cgacccaagg gcagcaaatc gagcgccttg

     7021 aagctggaca gccgtattga tgaagtacag gcatacgtga accttggctt gccgcaaagt

     7081 cgcgcagccg agttgttagg cgtcagccct cacaccttgc gcctgttcat caaacgccgg

     7141 aacatcaaac ccacaaacac tagaccaacc atcaccatgc cggggaggga acaacatgcc

     7201 taagaacaac aaagcccccg gccatcgtat caacgagatc atcaagacga gcctcgcgct

     7261 cgaaatggag gatgcccgcg aagctggctt agtcggctac atggcccgtt gccttgtgca

     7321 agcgaccatg ccccacaccg accccaagac cagctacttt gagcgcacca atggcatcgt

     7381 caccttgtcg atcatgggca agccgagcat cggcctgccc tacggttcta tgccgcgcac

     7441 cttgcttgct tggatatgca ccgaggccgt gcgaacgaaa gaccccgtgt tgaaccttgg

     7501 ccggtcgcaa tcggaatttc tacaaaggct cggaatgcac accgatggcc gttacacggc

     7561 cacccttcgc aatcaggcgc aacgcctgtt ttcatccatg atttcgcttg ccggcgagca

     7621 aggcaatgac ttcggcattg agaacgtcgt cattgccaag cgcgcttttc tattctggaa

     7681 tcccaagcgg ccagaagatc gggcgctatg ggatagcacc ctcaccctca caggcgattt

     7741 cttcgaggaa gtcacccgct caccggttcc tatccgaatc gactacctgc acgccttgcg

     7801 gcagtctccg cttgcgatgg acatttacac gtggctgacc tatcgcgtgt tcctgttgcg

     7861 ggccaagggc cgccccttcg tgcaaatccc ttgggtcgcc ctgcaagcgc aattcggctc

     7921 atcctatggc agccgcgcac gcaactcgcc cgaactggac gataaggccc gagagcgggc

     7981 agagcgggca gcactcgcca gcttcaaata caacttcaaa aagcgcctac gcgaagtgtt

     8041 gattgtctat cccgaggcaa gcgactgcat cgaagatgac ggcgaatgcc tgcgcatcaa

     8101 atccacacgc ctgcatgtca cccgcgcacc cggcaagggc gctcgcatcg gcccccctcc

     8161 gacttgacca ggccaacgct acgcttggct tggtcaagga tcgatctggc gccggccagc

     8221 gagacgagca agattggccg ccgcccgaaa cgatccgaca gcgcgcccag cacaggtgcg

     8281 caggcaaatt gcaccaacgc atacagcgcc agcagaatgc catagtgggc ggtgacgtcg

     8341 ttcgagtgaa ccagatcgcg caggaggccc ggcagcaccg gcataatcag gccgatgccg

     8401 acagcgtcga gcgcgacagt gctcagaatt acgatcaggg gtatgttggg tttcacgtct

     8461 ggcctccgga ccagcctccg ctggtccgat tgaacgcgcg gattctttat cactgataag

     8521 ttggtggaca tattatgttt atcagtgata aagtgtcaag catgacaaag ttgcagccga

     8581 atacagtgat ccgtgccgcc ctggacctgt tgaacgaggt cggcgtagac ggtctgacga

     8641 cacgcaaact ggcggaacgg ttgggggttc agcagccggc gctttactgg cacttcagga

     8701 acaagcgggc gctgctcgac gcactggccg aagccatgct ggcggagaat catacgcatt

     8761 cggtgccgag agccgacgac gactggcgct catttctgat cgggaatgcc cgcagcttca

     8821 ggcaggcgct gctcgcctac cgcgatggcg cgcgcatcca tgccggcacg cgaccgggcg

     8881 caccgcagat ggaaacggcc gacgcgcagc ttcgcttcct ctgcgaggcg ggtttttcgg

     8941 ccggggacgc cgtcaatgcg ctgatgacaa tcagctactt cactgttggg gccgtgcttg

     9001 aggagcaggc cggcgacagc gatgccggcg agcgcggcgg caccgttgaa caggctccgc

     9061 tctcgccgct gttgcgggcc gcgatagacg ccttcgacga agccggtccg gacgcagcgt

     9121 tcgagcaggg actcgcggtg attgtcgatg gattggcgaa aaggaggctc gttgtcagga

     9181 acgttgaagg accgagaaag ggtgacgatt gatcaggacc gctgccggag cgcaacccac

     9241 tcactacagc agagccatgt agacaacatc ccctc

//

 

Caution:
1.  This product is FOR RESEARCH USE ONLY!
2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart