pSP64 Plasmid

$216.00

  • Model: PVT0013
  • 50 Units in Stock
Ask a question


Add to Cart:

pSP64

Search name

pSP64,Plasmid pSP64,pSP64 vector

 

pSP64 Information

Carrier name: pSP64

Plasmid type: yeast two hybrid system carrier

High copy / low copy: high copy

Cloning methods: polyclonal sites, restrictive endonucleases

Carrier size: 2999bp

5'sequencing primers and sequences: Sp6 Fwd: ATTTAGGTGACACTATAG

Vector resistance: ampicillin (Ampicillian)

Stability: transient expression

Composition type: composition type

Virus / non virus: non virus

 

pSP64 Description

pSP64 Poly(A) Vector can be used as a standard cloning vector and for in vitro transcription from the SP6 promoter. The pSP64 Poly(A) Vector also can be used to generate poly(A)+ transcripts in vitro. The vector has a stretch of 30 dA:dT residues inserted between the SacI and EcoRI sites. Therefore, when foreign DNA is cloned into any polylinker site other than EcoRI (HindIII, PstI, SalI, AccI, HincII, XbaI, BamHI, AvaI, SmaI or SacI), linearization of the recombinant plasmid with EcoRI allows the use of SP6 RNA polymerase in vitro to prepare RNA copies of the inserted sequences that contain a synthetic 3′ "poly(A)" tail of 30 residues.

pSP64-plasmid

 

pSP64 Sequence

  LOCUS       pSP64 2999 bp  DNA SYN  DEFINITION  pSP64  ACCESSION     KEYWORDS      SOURCE          ORGANISM  other sequences; artificial sequences; vectors.  FEATURES             Location/Qualifiers       source          1..2999                       /organism="pSP64"                       /mol_type="other DNA"       promoter        complement(63..81)                       /label="M13_reverse_primer"       misc_feature    complement(80..102)                       /label="M13_pUC_rev_primer"       promoter        complement(116..145)                       /label="lac_promoter"       gene            complement(1228..2088)                       /label="Ampicillin"                       /gene="Ampicillin"       CDS             complement(1228..2088)                       /label="ORF frame 3"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       promoter        complement(2130..2158)                       /label="AmpR_promoter"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       misc_feature    complement(2317..2339)                       /label="pGEX_3_primer"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       gene            complement(2490..2741)                       /label="tet (887 - 636)"                       /gene="tet (887 - 636)"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       misc_feature    2673..2692                       /label="pBRrevBam_primer"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       misc_feature    2983..1                       /label="Sp6_primer"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"  ORIGIN      1 gaatacaagc ttgggctgca ggtcgactct agaggatccc cgggcgagct cgaattcgta     61 atcatggtca tagctgtttc ctgtgtgaaa ttgttatccg ctcacaattc cacacaacat    121 acgagccgga agcataaagt gtaaagcctg gggtgcctaa tgagtgagct aactcacatt    181 aattgcgttg cgctcactgc ccgctttcca gtcgggaaac ctgtcgtgcc agctgcatta    241 atgaatcggc caacgcgcgg ggagaggcgg tttgcgtatt gggcgctctt ccgcttcctc    301 gctcactgac tcgctgcgct cggtcgttcg gctgcggcga gcggtatcag ctcactcaaa    361 ggcggtaata cggttatcca cagaatcagg ggataacgca ggaaagaaca tgtgagcaaa    421 aggccagcaa aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt tccataggct    481 ccgcccccct gacgagcatc acaaaaatcg acgctcaagt cagaggtggc gaaacccgac    541 aggactataa agataccagg cgtttccccc tggaagctcc ctcgtgcgct ctcctgttcc    601 gaccctgccg cttaccggat acctgtccgc ctttctccct tcgggaagcg tggcgctttc    661 tcatagctca cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca agctgggctg    721 tgtgcacgaa ccccccgttc agcccgaccg ctgcgcctta tccggtaact atcgtcttga    781 gtccaacccg gtaagacacg acttatcgcc actggcagca gccactggta acaggattag    841 cagagcgagg tatgtaggcg gtgctacaga gttcttgaag tggtggccta actacggcta    901 cactagaagg acagtatttg gtatctgcgc tctgctgaag ccagttacct tcggaaaaag    961 agttggtagc tcttgatccg gcaaacaaac caccgctggt agcggtggtt tttttgtttg   1021 caagcagcag attacgcgca gaaaaaaagg atctcaagaa gatcctttga tcttttctac   1081 ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca tgagattatc   1141 aaaaaggatc ttcacctaga tccttttaaa ttaaaaatga agttttaaat caatctaaag   1201 tatatatgag taaacttggt ctgacagtta ccaatgctta atcagtgagg cacctatctc   1261 agcgatctgt ctatttcgtt catccatagt tgcctgactc cccgtcgtgt agataactac   1321 gatacgggag ggcttaccat ctggccccag tgctgcaatg ataccgcgag acccacgctc   1381 accggctcca gatttatcag caataaacca gccagccgga agggccgagc gcagaagtgg   1441 tcctgcaact ttatccgcct ccatccagtc tattaattgt tgccgggaag ctagagtaag   1501 tagttcgcca gttaatagtt tgcgcaacgt tgttgccatt gctacaggca tcgtggtgtc   1561 acgctcgtcg tttggtatgg cttcattcag ctccggttcc caacgatcaa ggcgagttac   1621 atgatccccc atgttgtgca aaaaagcggt tagctccttc ggtcctccga tcgttgtcag   1681 aagtaagttg gccgcagtgt tatcactcat ggttatggca gcactgcata attctcttac   1741 tgtcatgcca tccgtaagat gcttttctgt gactggtgag tactcaacca agtcattctg   1801 agaatagtgt atgcggcgac cgagttgctc ttgcccggcg tcaatacggg ataataccgc   1861 gccacatagc agaactttaa aagtgctcat cattggaaaa cgttcttcgg ggcgaaaact   1921 ctcaaggatc ttaccgctgt tgagatccag ttcgatgtaa cccactcgtg cacccaactg   1981 atcttcagca tcttttactt tcaccagcgt ttctgggtga gcaaaaacag gaaggcaaaa   2041 tgccgcaaaa aagggaataa gggcgacacg gaaatgttga atactcatac tcttcctttt   2101 tcaatattat tgaagcattt atcagggtta ttgtctcatg agcggataca tatttgaatg   2161 tatttagaaa aataaacaaa taggggttcc gcgcacattt ccccgaaaag tgccacctga   2221 cgtctaagaa accattatta tcatgacatt aacctataaa aataggcgta tcacgaggcc   2281 ctttcgtctc gcgcgtttcg gtgatgacgg tgaaaacctc tgacacatgc agctcccgga   2341 gacggtcaca gcttgtctgt aagcggatgc cgggagcaga caagcccgtc agggcgcgtc   2401 agcgggtgtt ggcgggtgtc ggggctggct taactatgcg gcatcagagc agattgtact   2461 gagagtgcac catatcgacg ctctccctta tgcgactcct gcattaggaa gcagcccagt   2521 agtaggttga ggccgttgag caccgccgcc gcaaggaatg gtgcatgcaa ggagatggcg   2581 cccaacagtc ccccggccac ggggcctgcc accataccca cgccgaaaca agcgctcatg   2641 agcccgaagt ggcgagcccg atcttcccca tcggtgatgt cggcgatata ggcgccagca   2701 accgcacctg tggcgccggt gatgccggcc acgatgcgtc cggcgtagag gatctggcta   2761 gcgatgaccc tgctgattgg ttcgctgacc atttccgggg tgcggaacgg cgttaccaga   2821 aactcagaag gttcgtccaa ccaaaccgac tctgacggca gtttacgaga gagatgatag   2881 ggtctgcttc agtaagccag atgctacaca attaggcttg tacatattgt cgttagaacg   2941 cggctacaat taatacataa ccttatgtat catacacata cgatttaggt gacactata  //
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart