pSPAX2

  • Model: PVT2320
  • 0 Units in Stock
Ask a question


 Sold Out 

pSPAX2

PVT2320      2ug

 

pSPAX2 Plasmid information

Promoter: SV40
Replicon: pUC ori, SV40 ori
Terminator: beta -globin poly (A) signal, SV40 poly (A) signal
Plasmid classification: virus series, lentivirus packaging vector
Plasmid size: 10668bp
Prokaryotic resistance: Amp
Clone strain: Stbl3
Culture conditions: 37 LB, aerobic
Expression host: mammalian cells
Induction method: no induction, transient expression
Primers for 5'sequencing: M13R:CAGGAAACAGCTATGACC
Primers for 3'sequencing: primers were designed according to the sequence
Use:Lentiviral

 

pSPAX2 Plasmid  Descrption

2nd generation packaging vector. Known to work with many of the Aebischer and Trono lab lentiviral vectors, as well as the pLKO system. Produces higher titer than pCMV-dR8.2 dvpr.

pSPAX2 vector

pSPAX2 Plasmid  Sequence

LOCUS       Exported               10703 bp ds-DNA     circular SYN 02-MAY-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..10703

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        4..383

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        386..661

                     /note="chicken beta-actin promoter"

     intron          662..1670

                     /note="chimeric intron"

                     /note="chimera between introns from chicken beta-actin and 

                     rabbit beta-globin"

     CDS             1780..3282

                     /codon_start=1

                     /gene="gag"

                     /product="gag protein from human immunodeficiency virus 1"

                     /note="HIV-1 gag"

                     /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFA

                     VNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKI

                     EEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKA

                     FSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGP

                     IAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTS

                     ILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPG

                     ATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEG

                     HIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAP

                     PEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ"

     CDS             3075..6086

                     /codon_start=1

                     /gene="pol"

                     /product="pol protein from human immunodeficiency virus 1"

                     /note="HIV-1 pol"

                     /translation="FFREDLAFPQGKAREFSSEQTRANSPTRRELQVWGRDNNSLSEAG

                     ADRQGTVSFSFPQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIG

                     GIGGFIKVGQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETV

                     PVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKD

                     STKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRK

                     YTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMD

                     DLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

                     VLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELEL

                     AENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHT

                     NDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTPP

                     LVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ

                     AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAH

                     KGIGGNEQVDGLVSAGIRKVLFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVA

                     SCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQET

                     AYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNK

                     ELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQK

                     QITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQ

                     MAGDDCVASRQDED"

     misc_feature    6660..6893

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     polyA_site      7792..7847

                     /note="beta-globin poly(A) signal"

                     /note="rabbit beta-globin polyadenylation signal"

     promoter        8379..8574

                     /note="SV40 promoter"

                     /note="SV40 early promoter"

     rep_origin      8425..8560

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     polyA_signal    8580..8714

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(8953..9541)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(9712..10572)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(10573..10677)

                     /gene="bla"

                     /note="AmpR promoter"

ORIGIN

        1 gtcgacattg attattgact agttattaat agtaatcaat tacggggtca ttagttcata

       61 gcccatatat ggagttccgc gttacataac ttacggtaaa tggcccgcct ggctgaccgc

      121 ccaacgaccc ccgcccattg acgtcaataa tgacgtatgt tcccatagta acgccaatag

      181 ggactttcca ttgacgtcaa tgggtggact atttacggta aactgcccac ttggcagtac

      241 atcaagtgta tcatatgcca agtacgcccc ctattgacgt caatgacggt aaatggcccg

      301 cctggcatta tgcccagtac atgaccttat gggactttcc tacttggcag tacatctacg

      361 tattagtcat cgctattacc atgggtcgag gtgagcccca cgttctgctt cactctcccc

      421 atctcccccc cctccccacc cccaattttg tatttattta ttttttaatt attttgtgca

      481 gcgatggggg cggggggggg gggggcgcgc gccaggcggg gcggggcggg gcgaggggcg

      541 gggcggggcg aggcggagag gtgcggcggc agccaatcag agcggcgcgc tccgaaagtt

      601 tccttttatg gcgaggcggc ggcggcggcg gccctataaa aagcgaagcg cgcggcgggc

      661 gggagtcgct gcgttgcctt cgccccgtgc cccgctccgc gccgcctcgc gccgcccgcc

      721 ccggctctga ctgaccgcgt tactcccaca ggtgagcggg cgggacggcc cttctcctcc

      781 gggctgtaat tagcgcttgg tttaatgacg gctcgtttct tttctgtggc tgcgtgaaag

      841 ccttaaaggg ctccgggagg gccctttgtg cgggggggag cggctcgggg ggtgcgtgcg

      901 tgtgtgtgtg cgtggggagc gccgcgtgcg gcccgcgctg cccggcggct gtgagcgctg

      961 cgggcgcggc gcggggcttt gtgcgctccg cgtgtgcgcg aggggagcgc ggccgggggc

     1021 ggtgccccgc ggtgcggggg ggctgcgagg ggaacaaagg ctgcgtgcgg ggtgtgtgcg

     1081 tgggggggtg agcagggggt gtgggcgcgg cggtcgggct gtaacccccc cctgcacccc

     1141 cctccccgag ttgctgagca cggcccggct tcgggtgcgg ggctccgtgc ggggcgtggc

     1201 gcggggctcg ccgtgccggg cggggggtgg cggcaggtgg gggtgccggg cggggcgggg

     1261 ccgcctcggg ccggggaggg ctcgggggag gggcgcggcg gccccggagc gccggcggct

     1321 gtcgaggcgc ggcgagccgc agccattgcc ttttatggta atcgtgcgag agggcgcagg

     1381 gacttccttt gtcccaaatc tggcggagcc gaaatctggg aggcgccgcc gcaccccctc

     1441 tagcgggcgc gggcgaagcg gtgcggcgcc ggcaggaagg aaatgggcgg ggagggcctt

     1501 cgtgcgtcgc cgcgccgccg tccccttctc catctccagc ctcggggctg ccgcaggggg

     1561 acggctgcct tcggggggga cggggcaggg cggggttcgg cttctggcgt gtgaccggcg

     1621 gctctagagc ctctgctaac catgttcatg ccttcttctt tttcctacag ctcctgggca

     1681 acgtgctggt tattgtgctg tctcatcatt ttggcaaaga attcgggccg gccgcgttga

     1741 cgcgcacggc aagaggcgag gggcggcgac tggtgagaga tgggtgcgag agcgtcagta

     1801 ttaagcgggg gagaattaga tcgatgggaa aaaattcggt taaggccagg gggaaagaaa

     1861 aaatataaat taaaacatat agtatgggca agcagggagc tagaacgatt cgcagttaat

     1921 cctggcctgt tagaaacatc agaaggctgt agacaaatac tgggacagct acaaccatcc

     1981 cttcagacag gatcagaaga acttagatca ttatataata cagtagcaac cctctattgt

     2041 gtgcatcaaa ggatagagat aaaagacacc aaggaagctt tagacaagat agaggaagag

     2101 caaaacaaaa gtaagaaaaa agcacagcaa gcagcagctg acacaggaca cagcaatcag

     2161 gtcagccaaa attaccctat agtgcagaac atccaggggc aaatggtaca tcaggccata

     2221 tcacctagaa ctttaaatgc atgggtaaaa gtagtagaag agaaggcttt cagcccagaa

     2281 gtgataccca tgttttcagc attatcagaa ggagccaccc cacaagattt aaacaccatg

     2341 ctaaacacag tggggggaca tcaagcagcc atgcaaatgt taaaagagac catcaatgag

     2401 gaagctgcag aatgggatag agtgcatcca gtgcatgcag ggcctattgc accaggccag

     2461 atgagagaac caaggggaag tgacatagca ggaactacta gtacccttca ggaacaaata

     2521 ggatggatga cacataatcc acctatccca gtaggagaaa tctataaaag atggataatc

     2581 ctgggattaa ataaaatagt aagaatgtat agccctacca gcattctgga cataagacaa

     2641 ggaccaaagg aaccctttag agactatgta gaccgattct ataaaactct aagagccgag

     2701 caagcttcac aagaggtaaa aaattggatg acagaaacct tgttggtcca aaatgcgaac

     2761 ccagattgta agactatttt aaaagcattg ggaccaggag cgacactaga agaaatgatg

     2821 acagcatgtc agggagtggg gggacccggc cataaagcaa gagttttggc tgaagcaatg

     2881 agccaagtaa caaatccagc taccataatg atacagaaag gcaattttag gaaccaaaga

     2941 aagactgtta agtgtttcaa ttgtggcaaa gaagggcaca tagccaaaaa ttgcagggcc

     3001 cctaggaaaa agggctgttg gaaatgtgga aaggaaggac accaaatgaa agattgtact

     3061 gagagacagg ctaatttttt agggaagatc tggccttccc acaagggaag gccagggaat

     3121 tttcttcaga gcagaccaga gccaacagcc ccaccagaag agagcttcag gtttggggaa

     3181 gagacaacaa ctccctctca gaagcaggag ccgatagaca aggaactgta tcctttagct

     3241 tccctcagat cactctttgg cagcgacccc tcgtcacaat aaagataggg gggcaattaa

     3301 aggaagctct attagataca ggagcagatg atacagtatt agaagaaatg aatttgccag

     3361 gaagatggaa accaaaaatg atagggggaa ttggaggttt tatcaaagta ggacagtatg

     3421 atcagatact catagaaatc tgcggacata aagctatagg tacagtatta gtaggaccta

     3481 cacctgtcaa cataattgga agaaatctgt tgactcagat tggctgcact ttaaattttc

     3541 ccattagtcc tattgagact gtaccagtaa aattaaagcc aggaatggat ggcccaaaag

     3601 ttaaacaatg gccattgaca gaagaaaaaa taaaagcatt agtagaaatt tgtacagaaa

     3661 tggaaaagga aggaaaaatt tcaaaaattg ggcctgaaaa tccatacaat actccagtat

     3721 ttgccataaa gaaaaaagac agtactaaat ggagaaaatt agtagatttc agagaactta

     3781 ataagagaac tcaagatttc tgggaagttc aattaggaat accacatcct gcagggttaa

     3841 aacagaaaaa atcagtaaca gtactggatg tgggcgatgc atatttttca gttcccttag

     3901 ataaagactt caggaagtat actgcattta ccatacctag tataaacaat gagacaccag

     3961 ggattagata tcagtacaat gtgcttccac agggatggaa aggatcacca gcaatattcc

     4021 agtgtagcat gacaaaaatc ttagagcctt ttagaaaaca aaatccagac atagtcatct

     4081 atcaatacat ggatgatttg tatgtaggat ctgacttaga aatagggcag catagaacaa

     4141 aaatagagga actgagacaa catctgttga ggtggggatt taccacacca gacaaaaaac

     4201 atcagaaaga acctccattc ctttggatgg gttatgaact ccatcctgat aaatggacag

     4261 tacagcctat agtgctgcca gaaaaggaca gctggactgt caatgacata cagaaattag

     4321 tgggaaaatt gaattgggca agtcagattt atgcagggat taaagtaagg caattatgta

     4381 aacttcttag gggaaccaaa gcactaacag aagtagtacc actaacagaa gaagcagagc

     4441 tagaactggc agaaaacagg gagattctaa aagaaccggt acatggagtg tattatgacc

     4501 catcaaaaga cttaatagca gaaatacaga agcaggggca aggccaatgg acatatcaaa

     4561 tttatcaaga gccatttaaa aatctgaaaa caggaaaata tgcaagaatg aagggtgccc

     4621 acactaatga tgtgaaacaa ttaacagagg cagtacaaaa aatagccaca gaaagcatag

     4681 taatatgggg aaagactcct aaatttaaat tacccataca aaaggaaaca tgggaagcat

     4741 ggtggacaga gtattggcaa gccacctgga ttcctgagtg ggagtttgtc aatacccctc

     4801 ccttagtgaa gttatggtac cagttagaga aagaacccat aataggagca gaaactttct

     4861 atgtagatgg ggcagccaat agggaaacta aattaggaaa agcaggatat gtaactgaca

     4921 gaggaagaca aaaagttgtc cccctaacgg acacaacaaa tcagaagact gagttacaag

     4981 caattcatct agctttgcag gattcgggat tagaagtaaa catagtgaca gactcacaat

     5041 atgcattggg aatcattcaa gcacaaccag ataagagtga atcagagtta gtcagtcaaa

     5101 taatagagca gttaataaaa aaggaaaaag tctacctggc atgggtacca gcacacaaag

     5161 gaattggagg aaatgaacaa gtagatgggt tggtcagtgc tggaatcagg aaagtactat

     5221 ttttagatgg aatagataag gcccaagaag aacatgagaa atatcacagt aattggagag

     5281 caatggctag tgattttaac ctaccacctg tagtagcaaa agaaatagta gccagctgtg

     5341 ataaatgtca gctaaaaggg gaagccatgc atggacaagt agactgtagc ccaggaatat

     5401 ggcagctaga ttgtacacat ttagaaggaa aagttatctt ggtagcagtt catgtagcca

     5461 gtggatatat agaagcagaa gtaattccag cagagacagg gcaagaaaca gcatacttcc

     5521 tcttaaaatt agcaggaaga tggccagtaa aaacagtaca tacagacaat ggcagcaatt

     5581 tcaccagtac tacagttaag gccgcctgtt ggtgggcggg gatcaagcag gaatttggca

     5641 ttccctacaa tccccaaagt caaggagtaa tagaatctat gaataaagaa ttaaagaaaa

     5701 ttataggaca ggtaagagat caggctgaac atcttaagac agcagtacaa atggcagtat

     5761 tcatccacaa ttttaaaaga aaagggggga ttggggggta cagtgcaggg gaaagaatag

     5821 tagacataat agcaacagac atacaaacta aagaattaca aaaacaaatt acaaaaattc

     5881 aaaattttcg ggtttattac agggacagca gagatccagt ttggaaagga ccagcaaagc

     5941 tcctctggaa aggtgaaggg gcagtagtaa tacaagataa tagtgacata aaagtagtgc

     6001 caagaagaaa agcaaagatc atcagggatt atggaaaaca gatggcaggt gatgattgtg

     6061 tggcaagtag acaggatgag gattaacaca tggaattctg caacaactgc tgtttatcca

     6121 tttcagaatt gggtgtcgac atagcagaat aggcgttact cgacagagga gagcaagaaa

     6181 tggagccagt agatcctaga ctagagccct ggaagcatcc aggaagtcag cctaaaactg

     6241 cttgtaccaa ttgctattgt aaaaagtgtt gctttcattg ccaagtttgt ttcatgacaa

     6301 aagccttagg catctcctat ggcaggaaga agcggagaca gcgacgaaga gctcatcaga

     6361 acagtcagac tcatcaagct tctctatcaa agcagtaagt agtacatgta atgcaaccta

     6421 taatagtagc aatagtagca ttagtagtag caataataat agcaatagtt gtgtggtcca

     6481 tagtaatcat agaatatagg aaaatggccg ctgatcttca gacctggagg aggagatatg

     6541 agggacaatt ggagaagtga attatataaa tataaagtag taaaaattga accattagga

     6601 gtagcaccca ccaaggcaaa gagaagagtg gtgcagagag aaaaaagagc agtgggaata

     6661 ggagctttgt tccttgggtt cttgggagca gcaggaagca ctatgggcgc agcctcaatg

     6721 acgctgacgg tacaggccag acaattattg tctggtatag tgcagcagca gaacaatttg

     6781 ctgagggcta ttgaggcgca acagcatctg ttgcaactca cagtctgggg catcaagcag

     6841 ctccaagcaa gaatcctagc tgtggaaaga tacctaaagg atcaacagct cctagggatt

     6901 tggggttgct ctggaaaact catttgcacc actgctgtgc cttggaatgc tagttggagt

     6961 aataaatctc tggaacagat ctggaatcac acgacctgga tggagtggga cagagaaatt

     7021 aacaattaca caagcttaat acactcctta attgaagaat cgcaaaacca gcaagaaaag

     7081 aatgaacaag aattattgga attagataaa tgggcaagtt tgtggaattg gtttaacata

     7141 acaaattggc tgtggtatat aaaattattc ataatgatag taggaggctt ggtaggttta

     7201 agaatagttt ttgctgtact ttctatagtg aatagagtta ggcagggata ttcaccatta

     7261 tcgtttcaga cccacctccc aatcccgagg ggacccgaca ggcccgaagg aatagaagaa

     7321 gaaggtggag agagagacag agacagatcc attcgattag tgaacggatc cttggcactt

     7381 atctgggacg atctgcggag cctgtgcctc ttcagctacc accgcttgag agacttactc

     7441 ttgattgtaa cgaggattgt ggaacttctg ggacgcaggg ggtgggaagc cctcaaatat

     7501 tggtggaatc tcctacaata ttggagtcag gagctaaaga atagtgctgt tagcttgctc

     7561 aatgccacag ccatagcagt agctgagggg acagataggg ttatagaagt agtacaagga

     7621 gcttgtagag ctattcgcca catacctaga agaataagac agggcttgga aaggattttg

     7681 ctataagctc gaaacaaccg gtacctctag aactatagct agcagatctt tttccctctg

     7741 ccaaaaatta tggggacatc atgaagcccc ttgagcatct gacttctggc taataaagga

     7801 aatttatttt cattgcaata gtgtgttgga attttttgtg tctctcactc ggaaggacat

     7861 atgggagggc aaatcattta aaacatcaga atgagtattt ggtttagagt ttggcaacat

     7921 atgccatatg ctggctgcca tgaacaaagg tggctataaa gaggtcatca gtatatgaaa

     7981 cagccccctg ctgtccattc cttattccat agaaaagcct tgacttgagg ttagattttt

     8041 tttatatttt gttttgtgtt atttttttct ttaacatccc taaaattttc cttacatgtt

     8101 ttactagcca gatttttcct cctctcctga ctactcccag tcatagctgt ccctcttctc

     8161 ttatgaagat ccctcgacct gcagcccaag cttggcgtaa tcatggtcat agctgtttcc

     8221 tgtgtgaaat tgttatccgc tcacaattcc acacaacata cgagccggaa gcataaagtg

     8281 taaagcctgg ggtgcctaat gagtgagcta actcacatta attgcgttgc gctcactgcc

     8341 cgctttccag tcgggaaacc tgtcgtgcca gcggatccgc atctcaatta gtcagcaacc

     8401 atagtcccgc ccctaactcc gcccatcccg cccctaactc cgcccagttc cgcccattct

     8461 ccgccccatg gctgactaat tttttttatt tatgcagagg ccgaggccgc ctcggcctct

     8521 gagctattcc agaagtagtg aggaggcttt tttggaggcc taggcttttg caaaaagcta

     8581 acttgtttat tgcagcttat aatggttaca aataaagcaa tagcatcaca aatttcacaa

     8641 ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt

     8701 atcatgtctg gatccgctgc attaatgaat cggccaacgc gcggggagag gcggtttgcg

     8761 tattgggcgc tcttccgctt cctcgctcac tgactcgctg cgctcggtcg ttcggctgcg

     8821 gcgagcggta tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa

     8881 cgcaggaaag aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc

     8941 gttgctggcg tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc

     9001 aagtcagagg tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag

     9061 ctccctcgtg cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct

     9121 cccttcggga agcgtggcgc tttctcaatg ctcacgctgt aggtatctca gttcggtgta

     9181 ggtcgttcgc tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc

     9241 cttatccggt aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc

     9301 agcagccact ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt

     9361 gaagtggtgg cctaactacg gctacactag aaggacagta tttggtatct gcgctctgct

     9421 gaagccagtt accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc

     9481 tggtagcggt ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca

     9541 agaagatcct ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta

     9601 agggattttg gtcatgagat tatcaaaaag gatcttcacc tagatccttt taaattaaaa

     9661 atgaagtttt aaatcaatct aaagtatata tgagtaaact tggtctgaca gttaccaatg

     9721 cttaatcagt gaggcaccta tctcagcgat ctgtctattt cgttcatcca tagttgcctg

     9781 actccccgtc gtgtagataa ctacgatacg ggagggctta ccatctggcc ccagtgctgc

     9841 aatgataccg cgagacccac gctcaccggc tccagattta tcagcaataa accagccagc

     9901 cggaagggcc gagcgcagaa gtggtcctgc aactttatcc gcctccatcc agtctattaa

     9961 ttgttgccgg gaagctagag taagtagttc gccagttaat agtttgcgca acgttgttgc

    10021 cattgctaca ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat tcagctccgg

    10081 ttcccaacga tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag cggttagctc

    10141 cttcggtcct ccgatcgttg tcagaagtaa gttggccgca gtgttatcac tcatggttat

    10201 ggcagcactg cataattctc ttactgtcat gccatccgta agatgctttt ctgtgactgg

    10261 tgagtactca accaagtcat tctgagaata gtgtatgcgg cgaccgagtt gctcttgccc

    10321 ggcgtcaata cgggataata ccgcgccaca tagcagaact ttaaaagtgc tcatcattgg

    10381 aaaacgttct tcggggcgaa aactctcaag gatcttaccg ctgttgagat ccagttcgat

    10441 gtaacccact cgtgcaccca actgatcttc agcatctttt actttcacca gcgtttctgg

    10501 gtgagcaaaa acaggaaggc aaaatgccgc aaaaaaggga ataagggcga cacggaaatg

    10561 ttgaatactc atactcttcc tttttcaata ttattgaagc atttatcagg gttattgtct

    10621 catgagcgga tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac

    10681 atttccccga aaagtgccac ctg

//

 

Caution:
Product is for research use only!

 

Search name

pSPAX2,Plasmid pSPAX2,pSPAX2 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart