pSTOP1622

$260.00

  • Model: PVT11293
  • 50 Units in Stock
Ask a question


Add to Cart:

pSTOP1622

Catalog No. PVT11293
Packing 2ug

 

pSTOP1622 Information
Resistance Amp
Strain DH5alpha
Culture temperature 37degrees centigrade

 

pSTOP1622 Description

PSTOP1622 plasmid is a Bacillus subtilis carrier. Bacillus megaterium is a rod-shaped, non-pathogenic Gram-positive bacterium, which is able to grow on a wide variety of carbon sources. Like other soil bacteria, it is able to secrete high amount of protein into the culture medium (up to 0.5 g/L of recombinant protein). This property, together with its ability to grow in many ecological niches such as waste from meat industry, melasse or petrochemical effluents makes it an interesting organism for industrial-scale production of recombinant proteins. In addition to B. subtilis, it has been used as Gram-positive model organism for studying several research topics such as biochemistry, sporulation, and bacteriophages.

pSTOP1622-vector

pSTOP1622-plasmid

 

pSTOP1622 Sequence

LOCUS       Exported                6535 bp ds-DNA     circular SYN 26-NOV-2017
DEFINITION  synthetic circular DNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6535)
             
FEATURES             Location/Qualifiers
     source          1..6535
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     misc_feature    398..432
                     /label=xylA Promoter
     misc_feature    500..512
                     /label=RBS
     misc_feature    520..608
                     /label=MCS
     rep_origin      complement(741..1329)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1500..2360)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(2361..2465)
                     /gene="bla"
                     /label=AmpR promoter
     CDS             complement(2629..4005)
                     /codon_start=1
                     /gene="Bacillus subtilis tetL"
                     /product="tetracycline efflux protein"
                     /label=TcR
                     /note="confers resistance to tetracycline"
                     /translation="MNTSYSQSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFN
                     KPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFS
                     LLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIA
                     HYIHWSYLLLIPMITIITVPFLMKLLKKEVRIKGHFDIKGIILMSVGIVFFMLFTTSYS
                     ISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGGIIFGTVAGFVSMVPY
                     MMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSFLTA
                     SFLLETTSWFMTIIIVFVLGGLSFTKTVISTIVSSSLKQQEAGAGMSLLNFTSFLSEGT
                     GIAIVGGLLSIPLLDQRLLPMEVDQSTYLYSNLLLLFSGIIVISWLVTLNVYKHSQRDF
                     "
     CDS             complement(4205..5209)
                     /codon_start=1
                     /gene="repB"
                     /product="RepB replication protein"
                     /label=repB
                     /note="from Enterococcus faecalis plasmid pAM-alpha-1"
                     /db_xref="GI:22652809"
                     /protein_id="AAN03827.1"
                     /translation="MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDY
                     FELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGI
                     QSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLV
                     GFMRATEVTINNKDNSYNQHMHVLVCVEPTYFKNTENYVNQKQWIQFWKKAMKLDYDPN
                     VKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNLKRLSDLEEGLHRKRLIS
                     YGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE"
     CDS             complement(5663..252)
                     /codon_start=1
                     /label=xylR
                     /translation="MNQKLILDEILKNSPVSRATLSEITGLNKSTVSSQVNTLLEKDFI
                     FEIGAGQSRGGRRPVMLVFNKNAGYSIGIDIGVDYLNGILTDLEGNIILEKTSDLSSSS
                     ASEVKEILFALIHGFVTHMPESPYGLVGIGICVPGLVDRHQQIIFMPNLNWNIKDLQFL
                     IESEFNVPVFVENEANAGAYGEKVFGMTKNYENIVYISINIGIGTGLVINNELYKGVQG
                     FSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLASLSKEEKNISRKEIVERANKNDV
                     EMLNALQNFGFYIGIGLTNILNTFDIEAVILRNHIIESHPIVLNTIKNEVSSRVHSHLD
                     NKCELLPSSLGKNAPALGAVSIVIDSFLSVTPIS"
ORIGIN
        1 aattccgtta agatagtcga ctcctatatc aataccaatc gagtagcctg cattcttatt
       61 aaaaacaagc attacaggtc ttctgccgcc tctagattgc cctgccccaa tttcaaaaat
      121 aaaatctttt tcaagcagtg tatttacttg agaggagaca gtagacttgt ttaatcctgt
      181 aatctcagag agagttgccc tggagacagg ggagttcttc aaaatttcat ctaatattaa
      241 tttttgattc atttttttta ctaaagcttg atctgcaatt tgaataataa ccactccttt
      301 gtttatccac cgaactaagt tggtgttttt tgaagcttga attagatatt taaaagtatc
      361 atatctaata ttataactaa attttctaaa aaaaacattg aaataaacat ttattttgta
      421 tatgatgaga taaagttagt ttattggata aacaaactaa ctcaattaag atagttgatg
      481 gataaacttg ttcacttaaa tcaaaggggg aaatgtacaa tggtccaaac tagttcgaag
      541 atctccggag ctcccgggat ccggtaccgg ccgcatgccg gctaaacctc gcgaacggat
      601 tcaccggtcc aagaattgga gccaatcaat tcttgcggag aactgtgaat gcgcaaacca
      661 acccttggca gaacatatcc atcgcgtccg ccatctccag cagccgcacg cggcgcatct
      721 cgggccgcgt tgctggcgtt tttccatagg ctccgccccc ctgacgagca tcacaaaaat
      781 cgacgctcaa gtcagaggtg gcgaaacccg acaggactat aaagatacca ggcgtttccc
      841 cctggaagct ccctcgtgcg ctctcctgtt ccgaccctgc cgcttaccgg atacctgtcc
      901 gcctttctcc cttcgggaag cgtggcgctt tctcatagct cacgctgtag gtatctcagt
      961 tcggtgtagg tcgttcgctc caagctgggc tgtgtgcacg aaccccccgt tcagcccgac
     1021 cgctgcgcct tatccggtaa ctatcgtctt gagtccaacc cggtaagaca cgacttatcg
     1081 ccactggcag cagccactgg taacaggatt agcagagcga ggtatgtagg cggtgctaca
     1141 gagttcttga agtggtggcc taactacggc tacactagaa ggacagtatt tggtatctgc
     1201 gctctgctga agccagttac cttcggaaaa agagttggta gctcttgatc cggcaaacaa
     1261 accaccgctg gtagcggtgg tttttttgtt tgcaagcagc agattacgcg cagaaaaaaa
     1321 ggatctcaag aagatccttt gatcttttct acggggtctg acgctcagtg gaacgaaaac
     1381 tcacgttaag ggattttggt catgagatta tcaaaaagga tcttcaccta gatcctttta
     1441 aattaaaaat gaagttttaa atcaatctaa agtatatatg agtaaacttg gtctgacagt
     1501 taccaatgct taatcagtga ggcacctatc tcagcgatct gtctatttcg ttcatccata
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart