pSTOP1622

$260.00

  • Model: PVT11293
  • 50 Units in Stock
Ask a question


Add to Cart:

pSTOP1622

Catalog No. PVT11293
Packing 2ug

 

pSTOP1622 Information
Resistance Amp
Strain DH5alpha
Culture temperature 37degrees centigrade

 

pSTOP1622 Description

PSTOP1622 plasmid is a Bacillus subtilis carrier. Bacillus megaterium is a rod-shaped, non-pathogenic Gram-positive bacterium, which is able to grow on a wide variety of carbon sources. Like other soil bacteria, it is able to secrete high amount of protein into the culture medium (up to 0.5 g/L of recombinant protein). This property, together with its ability to grow in many ecological niches such as waste from meat industry, melasse or petrochemical effluents makes it an interesting organism for industrial-scale production of recombinant proteins. In addition to B. subtilis, it has been used as Gram-positive model organism for studying several research topics such as biochemistry, sporulation, and bacteriophages.

pSTOP1622-vector

pSTOP1622-plasmid

 

pSTOP1622 Sequence

LOCUS       Exported                6535 bp ds-DNA     circular SYN 26-NOV-2017

DEFINITION  synthetic circular DNA

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6535)

FEATURES             Location/Qualifiers

     source          1..6535

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    398..432

                     /label=xylA Promoter

     misc_feature    500..512

                     /label=RBS

     misc_feature    520..608

                     /label=MCS

     rep_origin      complement(741..1329)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(1500..2360)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(2361..2465)

                     /gene="bla"

                     /label=AmpR promoter

     CDS             complement(2629..4005)

                     /codon_start=1

                     /gene="Bacillus subtilis tetL"

                     /product="tetracycline efflux protein"

                     /label=TcR

                     /note="confers resistance to tetracycline"

                     /translation="MNTSYSQSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFN

                     KPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFS

                     LLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIA

                     HYIHWSYLLLIPMITIITVPFLMKLLKKEVRIKGHFDIKGIILMSVGIVFFMLFTTSYS

                     ISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGGIIFGTVAGFVSMVPY

                     MMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSFLTA

                     SFLLETTSWFMTIIIVFVLGGLSFTKTVISTIVSSSLKQQEAGAGMSLLNFTSFLSEGT

                     GIAIVGGLLSIPLLDQRLLPMEVDQSTYLYSNLLLLFSGIIVISWLVTLNVYKHSQRDF

                     "

     CDS             complement(4205..5209)

                     /codon_start=1

                     /gene="repB"

                     /product="RepB replication protein"

                     /label=repB

                     /note="from Enterococcus faecalis plasmid pAM-alpha-1"

                     /db_xref="GI:22652809"

                     /protein_id="AAN03827.1"

                     /translation="MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDY

                     FELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGI

                     QSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLV

                     GFMRATEVTINNKDNSYNQHMHVLVCVEPTYFKNTENYVNQKQWIQFWKKAMKLDYDPN

                     VKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNLKRLSDLEEGLHRKRLIS

                     YGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE"

     CDS             complement(5663..252)

                     /codon_start=1

                     /label=xylR

                     /translation="MNQKLILDEILKNSPVSRATLSEITGLNKSTVSSQVNTLLEKDFI

                     FEIGAGQSRGGRRPVMLVFNKNAGYSIGIDIGVDYLNGILTDLEGNIILEKTSDLSSSS

                     ASEVKEILFALIHGFVTHMPESPYGLVGIGICVPGLVDRHQQIIFMPNLNWNIKDLQFL

                     IESEFNVPVFVENEANAGAYGEKVFGMTKNYENIVYISINIGIGTGLVINNELYKGVQG

                     FSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLASLSKEEKNISRKEIVERANKNDV

                     EMLNALQNFGFYIGIGLTNILNTFDIEAVILRNHIIESHPIVLNTIKNEVSSRVHSHLD

                     NKCELLPSSLGKNAPALGAVSIVIDSFLSVTPIS"

ORIGIN

        1 aattccgtta agatagtcga ctcctatatc aataccaatc gagtagcctg cattcttatt

       61 aaaaacaagc attacaggtc ttctgccgcc tctagattgc cctgccccaa tttcaaaaat

      121 aaaatctttt tcaagcagtg tatttacttg agaggagaca gtagacttgt ttaatcctgt

      181 aatctcagag agagttgccc tggagacagg ggagttcttc aaaatttcat ctaatattaa

      241 tttttgattc atttttttta ctaaagcttg atctgcaatt tgaataataa ccactccttt

      301 gtttatccac cgaactaagt tggtgttttt tgaagcttga attagatatt taaaagtatc

      361 atatctaata ttataactaa attttctaaa aaaaacattg aaataaacat ttattttgta

      421 tatgatgaga taaagttagt ttattggata aacaaactaa ctcaattaag atagttgatg

      481 gataaacttg ttcacttaaa tcaaaggggg aaatgtacaa tggtccaaac tagttcgaag

      541 atctccggag ctcccgggat ccggtaccgg ccgcatgccg gctaaacctc gcgaacggat

      601 tcaccggtcc aagaattgga gccaatcaat tcttgcggag aactgtgaat gcgcaaacca

      661 acccttggca gaacatatcc atcgcgtccg ccatctccag cagccgcacg cggcgcatct

      721 cgggccgcgt tgctggcgtt tttccatagg ctccgccccc ctgacgagca tcacaaaaat

      781 cgacgctcaa gtcagaggtg gcgaaacccg acaggactat aaagatacca ggcgtttccc

      841 cctggaagct ccctcgtgcg ctctcctgtt ccgaccctgc cgcttaccgg atacctgtcc

      901 gcctttctcc cttcgggaag cgtggcgctt tctcatagct cacgctgtag gtatctcagt

      961 tcggtgtagg tcgttcgctc caagctgggc tgtgtgcacg aaccccccgt tcagcccgac

     1021 cgctgcgcct tatccggtaa ctatcgtctt gagtccaacc cggtaagaca cgacttatcg

     1081 ccactggcag cagccactgg taacaggatt agcagagcga ggtatgtagg cggtgctaca

     1141 gagttcttga agtggtggcc taactacggc tacactagaa ggacagtatt tggtatctgc

     1201 gctctgctga agccagttac cttcggaaaa agagttggta gctcttgatc cggcaaacaa

     1261 accaccgctg gtagcggtgg tttttttgtt tgcaagcagc agattacgcg cagaaaaaaa

     1321 ggatctcaag aagatccttt gatcttttct acggggtctg acgctcagtg gaacgaaaac

     1381 tcacgttaag ggattttggt catgagatta tcaaaaagga tcttcaccta gatcctttta

     1441 aattaaaaat gaagttttaa atcaatctaa agtatatatg agtaaacttg gtctgacagt

     1501 taccaatgct taatcagtga ggcacctatc tcagcgatct gtctatttcg ttcatccata

     1561 gttgcctgac tccccgtcgt gtagataact acgatacggg agggcttacc atctggcccc

     1621 agtgctgcaa tgataccgcg agacccacgc tcaccggctc cagatttatc agcaataaac

     1681 cagccagccg gaagggccga gcgcagaagt ggtcctgcaa ctttatccgc ctccatccag

     1741 tctattaatt gttgccggga agctagagta agtagttcgc cagttaatag tttgcgcaac

     1801 gttgttgcca ttgctgcagg catcgtggtg tcacgctcgt cgtttggtat ggcttcattc

     1861 agctccggtt cccaacgatc aaggcgagtt acatgatccc ccatgttgtg caaaaaagcg

     1921 gttagctcct tcggtcctcc gatcgttgtc agaagtaagt tggccgcagt gttatcactc

     1981 atggttatgg cagcactgca taattctctt actgtcatgc catccgtaag atgcttttct

     2041 gtgactggtg agtactcaac caagtcattc tgagaatagt gtatgcggcg accgagttgc

     2101 tcttgcccgg cgtcaacacg ggataatacc gcgccacata gcagaacttt aaaagtgctc

     2161 atcattggaa aacgttcttc ggggcgaaaa ctctcaagga tcttaccgct gttgagatcc

     2221 agttcgatgt aacccactcg tgcacccaac tgatcttcag catcttttac tttcaccagc

     2281 gtttctgggt gagcaaaaac aggaaggcaa aatgccgcaa aaaagggaat aagggcgaca

     2341 cggaaatgtt gaatactcat actcttcctt tttcaatatt attgaagcat ttatcagggt

     2401 tattgtctca tgagcggata catatttgaa tgtatttaga aaaataaaca aataggggtt

     2461 ccgcgcacat ttccccgaaa agtgccacct gacgtctaag aaaccattat tatcatgaca

     2521 ttaacctata aaaataggcg tatcacgagg ccctttcgtc ttcaagaatt cctgttataa

     2581 aaaaaggatc aattttgaac tctctcccaa agttgatccc ttaacgattt agaaatccct

     2641 ttgagaatgt ttatatacat tcaaggtaac cagccaacta atgacaatga ttcctgaaaa

     2701 aagtaataac aaattactat acagataagt tgactgatca acttccatag gtaacaacct

     2761 ttgatcaagt aagggtatgg ataataaacc acctacaatt gcaatacctg ttccctctga

     2821 taaaaagctg gtaaagttaa gcaaactcat tccagcacca gcttcctgct gtttcaagct

     2881 acttgaaaca attgttgata taactgtttt ggtgaacgaa agcccaccta aaacaaatac

     2941 gattataatt gtcatgaacc atgatgttgt ttctaaaaga aaggaagcag ttaaaaagct

     3001 aacagaaaga aatgtaactc cgatgtttaa cacgtataaa ggacctcttc tatcaacaag

     3061 tatcccacca atgtagccga aaataatgac actcattgtt ccagggaaaa taattacact

     3121 tccgatttcg gcagtactta gctggtgaac atctttcatc atataaggaa ccatagagac

     3181 aaaccctgct actgttccaa atataattcc cccacaaaga actccaatca taaaaggtat

     3241 atttttccct aatccgggat caacaaaagg atctgttact ttcctgatat gttttacaaa

     3301 tatcaggaat gacagcacgc taacgataag aaaagaaatg ctatatgatg ttgtaaacaa

     3361 cataaaaaat acaatgccta cagacattag tataattcct ttgatatcaa aatgaccttt

     3421 tatccttact tctttcttta ataatttcat aagaaacgga acagtgataa ttgttatcat

     3481 aggaatgagt agaagatagg accaatgaat ataatgggct atcattccac caatcgctgg

     3541 accgactcct tctcccatgg ctactatcga tccaataaga ccaaatgctt tacccctatt

     3601 ttcctttgga atatagcgcg caactacaac cattacgagt gctggaaatg cagctgcacc

     3661 agccccttga ataaaacgag ccataataag taaggaaaag aaagaatggc caacaaaccc

     3721 aattaccgac ccgaaacaat ttattataat tccaaatagg agtaaccttt tgatgcctaa

     3781 ttgatcagat agctttccat atacagctgt tccaatggaa aaggttaaca taaaggctgt

     3841 gttcacccag tttgtactcg caggtggttt attaaaatca tttgcaatat caggtaatga

     3901 gacgttcaaa accatttcat ttaatacgct aaaaaaagat aaaatgcaaa gccaaattaa

     3961 aatttggttg tgtcgtaaat tcgattgtga ataggatgta ttcacatttc accctccaat

     4021 aatgagggca gacgtagttt atagggttaa tgatacgctt ccctctttta attgaaccct

     4081 gttacattca ttacacttca taattaattc ctcctaaact tgattaaaac attttaccac

     4141 atataaacta agttttaaat tcagtatttc atcacttata caacaatatg gcccgtttgt

     4201 tgaactactc tttaataaaa taatttttcc gttcccaatt ccacattgca ataatagaaa

     4261 atccatcttc atcggctttt tcgtcatcat ctgtatgaat caaatcgcct tcttctgtgt

     4321 catcaaggtt taatttttta tgtatttctt ttaacaaacc accataggag attaaccttt

     4381 tacggtgtaa accttcctcc aaatcagaca aacgtttcaa attcttttct tcatcatcgg

     4441 tcataaaatc cgtatccttt acaggatatt ttgcagtttc gtcaattgcc gattgtatat

     4501 ccgatttata tttatttttc ggtcgaatca tttgaacttt tacatttgga tcatagtcta

     4561 atttcattgc ctttttccaa aattgaatcc attgtttttg attcacgtag ttttctgtat

     4621 tcttaaaata agttggttcc acacatacca atacatgcat gtgctgatta taagaattat

     4681 ctttattatt tattgtcact tccgttgcac gcataaaacc aacaagattt ttattaattt

     4741 ttttatattg catcattcgg cgaaatcctt gagccatatc tgacaaactc ttatttaatt

     4801 cttcgccatc ataaacattt ttaactgtta atgtgagaaa caaccaacga actgttggct

     4861 tttgtttaat aacttcagca acaacctttt gtgactgaat gccatgtttc attgctctcc

     4921 tccagttgca cattggacaa agcctggatt tacaaaacca cactcgatac aactttcttt

     4981 cgcctgtttc acgattttgt ttatactcta atatttcagc acaatctttt actctttcag

     5041 cctttttaaa ttcaagaata tgcagaagtt caaagtaatc aacattagcg attttctttt

     5101 ctctccatgg tctcactttt ccactttttg tcttgtccac taaaaccctt gatttttcat

     5161 ctgaataaat gctactatta ggacacataa tattaaaaga aacccccatc tatttagtta

     5221 tttgtttggt cacttataac tttaacagat ggggtttttc tgtgcaacca attttaaggg

     5281 ttttcaatac tttaaaacac atacatacca acacttcaac gcacctttca gcaactaaaa

     5341 taaaaatgac gttatttcta tatgtatcaa gataagaaag aacaagttca aaaccatcaa

     5401 aaaaagacac cttttcaggt gcttttttta ttttataaac tcattccctg atctcgactt

     5461 cgttcttttt ttacctctcg gttatgagtt agttcaaatt cgttcttttt aggttctaaa

     5521 tcgtgttttt cttggaattg tgctgtttta tcctttacct tgtctacaaa ccccttaaaa

     5581 acgtttttaa aggcttttaa gccgtctgta cgttccttaa gatcaacgtg atataggttt

     5641 gctaaccttt gcgttcactt aactaactta taggggtaac acttaaaaaa gaatcaataa

     5701 cgatagaaac cgctcctaaa gcaggtgcat tttttcctaa cgaagaaggc aatagttcac

     5761 atttattgtc taaatgagaa tggactctag aagaaacttc gtttttaatc gtatttaaaa

     5821 caatgggatg agattcaatt atatgatttc tcaagataac agcttctata tcaaatgtat

     5881 taaggatatt ggttaatcca attccgatat aaaagccaaa gttttgaagt gcatttaaca

     5941 tttctacatc atttttattt gcgcgttcca caatctcttt tcgagaaata ttcttttctt

     6001 ctttagagag cgaagccagt aacgcttttt cagaagcata taattcccaa cagcctcgat

     6061 ttccacagct gcatttgggt ccattaaaat ctatcgtcat atgacccatt tccccagaaa

     6121 aaccctgaac acctttatac aattcgttgt taataacaag tccagttcca attccgatat

     6181 taatactgat gtaaacgatg ttttcatagt tttttgtcat accaaatact ttttcaccgt

     6241 atgctcctgc attagcttca ttttcaacaa aaaccggaac attaaactca ctctcaatta

     6301 aaaactgcaa atctttgata ttccaattta agttaggcat gaaaataatt tgctgatgac

     6361 gatctacaag gcctggaaca caaattccta ttccgactag accataaggg gactcaggca

     6421 tatgggttac aaaaccatga ataagtgcaa ataaaatctc ttttacttca ctagcggaag

     6481 aactagacaa gtcagaagtc ttctcgagaa taatatttcc ttctaagtcg gttag

//

Caution:
1.  This product is FOR RESEARCH USE ONLY!
2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart