pSUP202 Plasmid

$216.00

  • Model: PVT6019
  • 49 Units in Stock
Ask a question


Add to Cart:

pSUP202 Plasmid

PVT6019   2ug                                   

 

pSUP202 Plasmid Information

Bacterial Resistance:Ampicillin
Growth Strain: DH5α
Growth Condition: LB/37

Marker: Chl
Use:Homologous recombination HR plasmid

 

pSUP202 Sequence

LOCUS Exported 7830 bp ds-DNA linear UNA 31-12-2015

DEFINITION natural linear DNA

ACCESSION .

VERSION .

KEYWORDS pSUP202

SOURCE natural DNA sequence

ORGANISM unspecified

REFERENCE 1 (bases 1 to 7830)

AUTHORS .

TITLE Direct Submission

JOURNAL Exported 2015-12-31

FEATURES Location/Qualifiers

source 1..7830

/organism="unspecified"

/mol_type="genomic DNA"

promoter 599..627

/note="tet promoter"

/note="E. coli promoter for tetracycline efflux protein

gene"

CDS 675..1865

/codon_start=1

/gene="tet"

/product="tetracycline efflux protein"

/note="TcR"

/note="confers resistance to tetracycline"

/translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY

GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI

VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF

LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM

QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII

AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL

AALTSLTSIIGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"

CDS 2504..2695

/codon_start=1

/gene="rop"

/product="Rop protein, which maintains plasmids at low copy

number"

/note="rop"

/translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA

DELYRSCLARFGDDGENL"

misc_feature 2797..2937

/note="bom"

/note="basis of mobility region from pBR322"

CDS complement(3884..4744)

/codon_start=1

/gene="bla"

/product="beta-lactamase"

/note="AmpR"

/note="confers resistance to ampicillin, carbenicillin, and

related antibiotics"

/translation="[TEM beta-lactamase fragment, 45 aa]

ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

[TEM beta-lactamase fragment, 59 aa]

EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

[TEM beta-lactamase fragment, 59 aa]

LIKHW"

promoter complement(4745..4849)

/gene="bla"

/note="AmpR promoter"

promoter 5052..5154

/note="cat promoter"

/note="promoter of the E. coli cat gene encoding

chloramphenicol acetyltransferase"

CDS 5155..5814

/codon_start=1

/gene="cat"

/product="chloramphenicol acetyltransferase"

/note="CmR"

/note="confers resistance to chloramphenicol"

/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

CDS complement(6666..7037)

/codon_start=1

/gene="traJ"

/product="oriT-recognizing protein"

/note="traJ"

/translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

KQDELGKVMMGVVRPRAEP"

oriT 7070..7179

/note="incP origin of transfer"

ORIGIN

1 gcagggcaag ggcggggtcg gcaagtcggc catcgccgcg atcattgcgc agtacaagat

61 ggacaagggg cagacaccct tgtgcatcga caccgacccg gtgaacgcga cgttcgaggg

121 ctacaaggcc ctgaacgtcc gccggctgaa catcatggcc ggcgacgaaa ttaactcgcg

181 caacttcgac accctggtcg agctgattgc gccgaccaag gatgacgtgg tgatcctcta

241 cgccggacgc atcgtggccg gcatcaccgg cgccacaggt gcggttgctg gcgcctatat

301 cgccgacatc accgatgggg aagatccttg aagctgtccc tgatggtcgt catctacctg

361 cctggacagc atggcctgca acgcgggcat cccgatgccg ccggaagcga gaagaatcat

421 aatggggaag gccatccagc ctcgcgtcgc gaacgccagc aagacgtagc ccagcgcgtc

481 ggccgccatg ccggcgataa tggcctgctt ctcgccgaaa cgtttggtgg cgggaccagt

541 gacgaaggct tgagcgaggg cgtgcaagat tccgaatacc gcaagcgaca ggccatgttt

601 gacagcttat catcgataag ctttaatgcg gtagtttatc acagttaaat tgctaacgca

661 gtcaggcacc gtgtatgaaa tctaacaatg cgctcatcgt catcctcggc accgtcaccc

721 tggatgctgt aggcataggc ttggttatgc cggtactgcc gggcctcttg cgggatatcg

781 tccattccga cagcatcgcc agtcactatg gcgtgctgct agcgctatat gcgttgatgc

841 aatttctatg cgcacccgtt ctcggagcac tgtccgaccg ctttggccgc cgcccagtcc

901 tgctcgcttc gctacttgga gccactatcg actacgcgat catggcgacc acacccgtcc

961 tgtggatcct ctacgccgga cgcatcgtgg ccggcatcac cggcgccaca ggtgcggttg

1021 ctggcgccta tatcgccgac atcaccgatg gggaagatcg ggctcgccac ttcgggctca

1081 tgagcgcttg tttcggcgtg ggtatggtgg caggccccgt ggccggggga ctgttgggcg

1141 ccatctcctt gcatgcacca ttccttgcgg cggcggtgct caacggcctc aacctactac

1201 tgggctgctt cctaatgcag gagtcgcata agggagagcg tcgaccgatg cccttgagag

1261 ccttcaaccc agtcagctcc ttccggtggg cgcggggcat gactatcgtc gccgcactta

1321 tgactgtctt ctttatcatg caactcgtag gacaggtgcc ggcagcgctc tgggtcattt

1381 tcggcgagga ccgctttcgc tggagcgcga cgatgatcgg cctgtcgctt gcggtattcg

1441 gaatcttgca cgccctcgct caagccttcg tcactggtcc cgccaccaaa cgtttcggcg

1501 agaagcaggc cattatcgcc ggcatggcgg ccgacgcgct gggctacgtc ttgctggcgt

1561 tcgcgacgcg aggctggatg gccttcccca ttatgattct tctcgcttcc ggcggcatcg

1621 ggatgcccgc gttgcaggcc atgctgtcca ggcaggtaga tgacgaccat cagggacagc

1681 ttcaaggatc gctcgcggct cttaccagcc taacttcgat cattggaccg ctgatcgtca

1741 cggcgattta tgccgcctcg gcgagcacat ggaacgggtt ggcatggatt gtaggcgccg

1801 ccctatacct tgtctgcctc cccgcgttgc gtcgcggtgc atggagccgg gccacctcga

1861 cctgaatgga agccggcggc acctcgctaa cggattcacc actccaagaa ttggagccaa

1921 tcaattcttg cggagaactg tgaatgcgca aaccaaccct tggcagaaca tatccatcgc

1981 gtccgccatc tccagcagcc gcacgcggcg catctcgggc agcgttgggt cctggccacg

2041 ggtgcgcatg atcgtgctcc tgtcgttgag gacccggcta ggctggcggg gttgccttac

2101 tggttagcag aatgaatcac cgatacgcga gcgaacgtga agcgactgct gctgcaaaac

2161 gtctgcgacc tgagcaacaa catgaatggt cttcggtttc cgtgtttcgt aaagtctgga

2221 aacgcggaag tcagcgccct gcaccattat gttccggatc tgcatcgcag gatgctgctg

2281 gctaccctgt ggaacaccta catctgtatt aacgaagcgc tggcattgac ccttgagtga

2341 tttttctctg gtcccgccgc attcataccg ccagttggtt accctcacaa cgttccagta

2401 accgggcatg ttcatcatca gtaacccgta tcgtgagcat cctctctcgt ttcatcggta

2461 tcattacccc catgaacaga aatccccctt acacggaggc atcatgacca aacaggaaaa

2521 aaccgccctt aacatggccc gctttatcag aagccagaca ttaacgcttc tggagaaact

2581 caacgagctg gacgcggatg aacaggcaga catctgtgaa tcgcttcacg accacgctga

2641 tgagctttac cgcagctgcc tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat

2701 gcagctcccg gagacggtca cagcttgtct gtaagcggat gccgggagca gacaagcccg

2761 tcagggcgcg tcagcgggtg ttggcgggtg tcggggcgca gccatgaccc agtcacgtag

2821 cgatagcgga gtgtatactg gcttaactat gcggcatcag agcagattgt actgagagtg

2881 caccatatgc ggtgtgaaat accgcacaga tgcgtaagga gaaaataccg catcaggcgc

2941 tcttccgctt cctcgctcac tgactcgctg cgctcggtcg ttcggctgcg gcgagcggta

3001 tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa cgcaggaaag

3061 aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg

3121 tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg

3181 tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg

3241 cgcttctcct gttccgaccc tgccgcttta ccggaatacc tgtccgcctt tctcccttcg

3301 gaagcgtggc gctttctcat agctcacgct gtaggtatct cagttcggtg taggtcgttc

3361 gctccaagct gggctgtgtg cacgaacccc ccgttcagcc cgaccgctgc gccttatccg

3421 gtaactatcg tcttgagtcc aacccggtaa gacacgactt atcgccactg gcagcagcca

3481 ctggtaacag gattagcaga gcgaggtatg taggcggtgc tacagagttc ttgaagtggt

3541 ggcctaacta cggctacact agaaggacag tatttggtat ctgcgctctg ctgaagccag

3601 ttaccttcgg aaaaagagtt ggtagctctt gatccggcaa acaaaccacc gctggtagcg

3661 gtggtttttt tgtttgcaag cagcagatta cgcgcagaaa aaaaggatct caagaagatc

3721 ctttgatctt ttctacgggg tctgacgctc agtggaacga aaactcacgt taagggattt

3781 tggtcatgag attatcaaaa aggatcttca cctagatcct tttaaattaa aaatgaagtt

3841 ttaaatcaat ctaaagtata tatgagtaaa cttggtctga cagttaccaa tgcttaatca

3901 gtgaggcacc tatctcagcg atctgtctat ttcgttcatc catagttgcc tgactccccg

3961 tcgtgtagat aactacgata cgggagggct taccatctgg ccccagtgct gcaatgatac

4021 cgcgagaccc acgctcaccg gctccagatt tatcagcaat aaaccagcca gccggaaggg

4081 ccgagcgcag aagtggtcct gcaactttat ccgcctccat ccagtctatt aattgttgcc

4141 gggaagctag agtaagtagt tcgccagtta atagtttgcg caacgttgtt gccattgctg

4201 caggcatcgt ggtgtcacgc tcgtcgtttg gtatggcttc attcagctcc ggttcccaac

4261 gatcaaggcg agttacatga tcccccatgt tgtgcaaaaa agcggttagc tccttcggtc

4321 ctccgatcgt tgtcagaagt aagttggccg cagtgttatc actcatggtt atggcagcac

4381 tgcataattc tcttactgtc atgccatccg taagatgctt ttctgtgact ggtgagtact

4441 caaccaagtc attctgagaa tagtgtatgc ggcgaccgag ttgctcttgc ccggcgtcaa

4501 cacgggataa taccgcgcca catagcagaa ctttaaaagt gctcatcatt ggaaaacgtt

4561 cttcggggcg aaaactctca aggatcttac cgctgttgag atccagttcg atgtaaccca

4621 ctcgtgcacc caactgatct tcagcatctt ttactttcac cagcgtttct gggtgagcaa

4681 aaacaggaag gcaaaatgcc gcaaaaaagg gaataagggc gacacggaaa tgttgaatac

4741 tcatactctt cctttttcaa tattattgaa gcatttatca gggttattgt ctcatgagcg

4801 gatacatatt tgaatgtatt tagaaaaata aacaaatagg ggttccgcgc acatttcccc

4861 gaaaagtgcc acctgacgtc taagaaacca ttattatcat gacattaacc tataaaaata

4921 ggcgtatcac gaggcccttt cgtcttcgaa taaatacctg tgacggaaga tcacttcgca

4981 gaataaataa atcctggtgt ccctgttgat accgggaagc cctgggccaa cttttggcga

5041 aaatgagacg ttgatcggca cgtaagaggt tccaactttc accataatga aataagatca

5101 ctaccgggcg tattttttga gttatcgaga ttttcaggag ctaaggaagc taaaatggag

5161 aaaaaaatca ctggatatac caccgttgat atatcccaat ggcatcgtaa agaacatttt

5221 gaggcatttc agtcagttgc tcaatgtacc tataaccaga ccgttcagct ggatattacg

5281 gcctttttaa agaccgtaaa gaaaaataag cacaagtttt atccggcctt tattcacatt

5341 cttgcccgcc tgatgaatgc tcatccggaa ttccgtatgg caatgaaaga cggtgagctg

5401 gtgatatggg atagtgttca cccttgttac accgttttcc atgagcaaac tgaaacgttt

5461 tcatcgctct ggagtgaata ccacgacgat ttccggcagt ttctacacat atattcgcaa

5521 gatgtggcgt gttacggtga aaacctggcc tatttcccta aagggtttat tgagaatatg

5581 tttttcgtct cagccaatcc ctgggtgagt ttcaccagtt ttgatttaaa cgtggccaat

5641 atggacaact tcttcgcccc cgttttcacc atgggcaaat attatacgca aggcgacaag

5701 gtgctgatgc cgctggcgat tcaggttcat catgccgttt gtgatggctt ccatgtcggc

5761 agaatgctta atgaattaca acagtactgc gatgagtggc agggcggggc gtaatttttt

5821 taaggcagtt attggtgccc ttaaacgcct ggttgctacg cctgaataag tgataataag

5881 cggatgaatg gcagaaattc gaaagcaaat tcgacccggt cgtcggttca gggcagggtc

5941 gttaaatagc cgcttatgtc tattgctggt ttaccggttt attgactacc ggaagcagtg

6001 tgaccgtgtg cttctcaaat gcctgaggcc agtttgctca ggctctcccc gtggaggtaa

6061 taattgacga tatgatccag ccgaccaggc tttccacgcc cgcgtgccgc tccatgtcgt

6121 tcgcgcggtt ctcggaaacg cgctgccgcg tttcgtgatt gtcacgctca agcccgtagt

6181 cccgttcgag cgtcgcgcag aggtcagcga gggcgcggta ggcccgatac ggctcatgga

6241 tggtgtttcg ggtcgggtga atcttgttga tggcgatatg gatgtgcagg ttgtcggtgt

6301 cgtgatgcac ggcactgacg cgctgatgct cggcgaagcc aagcccagcg cagatgcggt

6361 cctcaatcgc gcgcaacgtc tccgcgtcgg gcttctctcc cgcgcggaag ctaaccagca

6421 ggtgataggt cttgtcggcc tcggaacggg tgttgccgtg ctgggtcgcc atcacctcgg

6481 ccatgacagc gggcagggtg tttgcctcgc agttcgtgac gcgcacgtga cccaagcgct

6541 cggtcttgcc ttgctcgtcg gtgatgtact tcaccagctc cgcgaagtcg ctcttcttga

6601 tggagcgcat ggggacgtgc ttggcaatca cgcgcacccc ccggccgttt tagcggctaa

6661 aaaagtcatg gctctgccct cgggcggacc acgcccatca tgaccttgcc aagctcgtcc

6721 tgcttctctt cgatcttcgc cagcagggcg aggatcgtgg catcaccgaa ccgcgccgtg

6781 cgcgggtcgt cggtgagcca gagtttcagc aggccgccca ggcggcccag gtcgccattg

6841 atgcgggcca gctcgcggac gtgctcatag tccacgacgc ccgtgatttt gtagccctgg

6901 ccgacggcca gcaggtaggc cgacaggctc atgccggccg ccgccgcctt ttcctcaatc

6961 gctcttcgtt cgtctggaag gcagtacacc ttgataggtg ggctgccctt tctggttggc

7021 ttggtttcat cagccatccg cttgccctca tctgttacgc cggcggtagc cggccagcct

7081 cgcagagcag gattcccgtt gagcaccgcc aggtgcgaat aagggacagt gaagaaggaa

7141 cacccgctcg cgggtgggcc tacttcacct atgctgcccg gctgacgccg ttggatacac

7201 caaggaaagt ctacacgaac cctttggcaa aatcctgtat atcgtgcgaa aaaggatgga

7261 tataccgaaa aaatcgctat aatgaccccg aagcagggtt atgcagcgga aaagcgctgc

7321 ttccctgctg ttttgtggaa tatctaccga ctggaaacag gcaaatgcag gaaattactg

7381 aactgagggg acaggcgaga gacgatgcca aagagctaca ccgacgagct ggccgagtgg

7441 gttgaatccc gcgcggccaa gaagcgccgg cgtgatgagg ctgcggttgc gttcctggcg

7501 gtgagggcgg atgtcgaggc ggcgttagcg tccggctatg cgctcgtcac catttgggag

7561 cacatgcggg aaacggggaa ggtcaagttc tcctacgaga cgttccgctc gcacgccagg

7621 cggcacatca aggccaagcc cgccgatgtg cccgcaccgc aggccaaggc tgcggaaccc

7681 gcgccggcac ccaagacgcc ggagccacgg cggccgaagc aggggggcaa ggctgaaaag

7741 ccggcccccg ctgcggcccc gaccggcttc accttcaacc caacaccgga caaaaaggat

7801 ctactgtaat ggcgaaaatt cacatggttt

//

 

Caution:

  1. This product is FOR RESEARCH USE ONLY!
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart