pT2/ VENUS

$162.00

  • Model: PVT1041
  • 49 Units in Stock
Ask a question


Add to Cart:

pT2/ VENUS

PVT1041          2ug

 

pT2/ VENUS Information

Promoters: CAG
Replicon: pUC ori
Terminator: SV40 poly (A) signal
Plasmid classification: mammalian cells, protein overexpression vector
Plasmid size: 6123bp
Prokaryotic resistance: Amp
Clone strain: DH5 alpha
Culture conditions: 37 LB, aerobic
Expression host: mammalian cells
Induction method: no induction, transient expression
Primers for 5'sequencing: primers were designed according to the sequence
Primers for 3'sequencing: primers were designed according to the sequence

 

PVT1041 pT2/ VENUS Reference

Article:Generation of a polled phenotype in cattle using CRISPR/Cas

Author: Felix Gabor Schuster

Submitted in partial fulfilment of the requirements for the degree
DOCTOR OF PHILOSOPHY
(PhD)
awarded by the University of Veterinary Medicine Hannover
https://elib.tiho-hannover.de/servlets/MCRFileNodeServlet/tiho_derivate_00000391/schusterf-ss20.pdf

 

pT2/ VENUS Sequence

LOCUS       Exported                6123 bp ds-DNA     circular SYN 29-AUG-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pT2VENUS

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6123)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Monday, August 29, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..6123

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        complement(61..79)

                     /note="T3 promoter"

                     /note="promoter for bacteriophage T3 RNA polymerase"

     primer_bind     complement(100..116)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    124..140

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(148..178)

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    193..214

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(502..1090)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(1261..2121)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(2122..2226)

                     /gene="bla"

                     /note="AmpR promoter"

     rep_origin      2253..2708

                     /direction=RIGHT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     primer_bind     2849..2865

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        2875..2893

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     polyA_signal    3295..3416

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     intron          4169..5177

                     /note="chimeric intron"

                     /note="chimera between introns from chicken beta-actin and 

                     rabbit beta-globin"

     promoter        complement(5178..5453)

                     /note="chicken beta-actin promoter"

     enhancer        5456..5759

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

ORIGIN

        1 gggatcctct agctagagtc gacctcgatc gagggggggc ccggtaccca gcttttgttc

       61 cctttagtga gggttaattt cgagcttggc gtaatcatgg tcatagctgt ttcctgtgtg

      121 aaattgttat ccgctcacaa ttccacacaa catacgagcc ggaagcataa agtgtaaagc

      181 ctggggtgcc taatgagtga gctaactcac attaattgcg ttgcgctcac tgcccgcttt

      241 ccagtcggga aacctgtcgt gccagctgca ttaatgaatc ggccaacgcg cggggagagg

      301 cggtttgcgt attgggcgct cttccgcttc ctcgctcact gactcgctgc gctcggtcgt

      361 tcggctgcgg cgagcggtat cagctcactc aaaggcggta atacggttat ccacagaatc

      421 aggggataac gcaggaaaga acatgtgagc aaaaggccag caaaaggcca ggaaccgtaa

      481 aaaggccgcg ttgctggcgt ttttccatag gctccgcccc cctgacgagc atcacaaaaa

      541 tcgacgctca agtcagaggt ggcgaaaccc gacaggacta taaagatacc aggcgtttcc

      601 ccctggaagc tccctcgtgc gctctcctgt tccgaccctg ccgcttaccg gatacctgtc

      661 cgcctttctc ccttcgggaa gcgtggcgct ttctcatagc tcacgctgta ggtatctcag

      721 ttcggtgtag gtcgttcgct ccaagctggg ctgtgtgcac gaaccccccg ttcagcccga

      781 ccgctgcgcc ttatccggta actatcgtct tgagtccaac ccggtaagac acgacttatc

      841 gccactggca gcagccactg gtaacaggat tagcagagcg aggtatgtag gcggtgctac

      901 agagttcttg aagtggtggc ctaactacgg ctacactaga aggacagtat ttggtatctg

      961 cgctctgctg aagccagtta ccttcggaaa aagagttggt agctcttgat ccggcaaaca

     1021 aaccaccgct ggtagcggtg gtttttttgt ttgcaagcag cagattacgc gcagaaaaaa

     1081 aggatctcaa gaagatcctt tgatcttttc tacggggtct gacgctcagt ggaacgaaaa

     1141 ctcacgttaa gggattttgg tcatgagatt atcaaaaagg atcttcacct agatcctttt

     1201 aaattaaaaa tgaagtttta aatcaatcta aagtatatat gagtaaactt ggtctgacag

     1261 ttaccaatgc ttaatcagtg aggcacctat ctcagcgatc tgtctatttc gttcatccat

     1321 agttgcctga ctccccgtcg tgtagataac tacgatacgg gagggcttac catctggccc

     1381 cagtgctgca atgataccgc gagacccacg ctcaccggct ccagatttat cagcaataaa

     1441 ccagccagcc ggaagggccg agcgcagaag tggtcctgca actttatccg cctccatcca

     1501 gtctattaat tgttgccggg aagctagagt aagtagttcg ccagttaata gtttgcgcaa

     1561 cgttgttgcc attgctacag gcatcgtggt gtcacgctcg tcgtttggta tggcttcatt

     1621 cagctccggt tcccaacgat caaggcgagt tacatgatcc cccatgttgt gcaaaaaagc

     1681 ggttagctcc ttcggtcctc cgatcgttgt cagaagtaag ttggccgcag tgttatcact

     1741 catggttatg gcagcactgc ataattctct tactgtcatg ccatccgtaa gatgcttttc

     1801 tgtgactggt gagtactcaa ccaagtcatt ctgagaatag tgtatgcggc gaccgagttg

     1861 ctcttgcccg gcgtcaatac gggataatac cgcgccacat agcagaactt taaaagtgct

     1921 catcattgga aaacgttctt cggggcgaaa actctcaagg atcttaccgc tgttgagatc

     1981 cagttcgatg taacccactc gtgcacccaa ctgatcttca gcatctttta ctttcaccag

     2041 cgtttctggg tgagcaaaaa caggaaggca aaatgccgca aaaaagggaa taagggcgac

     2101 acggaaatgt tgaatactca tactcttcct ttttcaatat tattgaagca tttatcaggg

     2161 ttattgtctc atgagcggat acatatttga atgtatttag aaaaataaac aaataggggt

     2221 tccgcgcaca tttccccgaa aagtgccacc tgacgcgccc tgtagcggcg cattaagcgc

     2281 ggcgggtgtg gtggttacgc gcagcgtgac cgctacactt gccagcgccc tagcgcccgc

     2341 tcctttcgct ttcttccctt cctttctcgc cacgttcgcc ggctttcccc gtcaagctct

     2401 aaatcggggg ctccctttag ggttccgatt tagtgcttta cggcacctcg accccaaaaa

     2461 acttgattag ggtgatggtt cacgtagtgg gccatcgccc tgatagacgg tttttcgccc

     2521 tttgacgttg gagtccacgt tctttaatag tggactcttg ttccaaactg gaacaacact

     2581 caaccctatc tcggtctatt cttttgattt ataagggatt ttgccgattt cggcctattg

     2641 gttaaaaaat gagctgattt aacaaaaatt taacgcgaat tttaacaaaa tattaacgct

     2701 tacaatttcc attcgccatt caggctgcgc aactgttggg aagggcgatc ggtgcgggcc

     2761 tcttcgctat tacgccagct ggcgaaaggg ggatgtgctg caaggcgatt aagttgggta

     2821 acgccagggt tttcccagtc acgacgttgt aaaacgacgg ccagtgagcg cgcgtaatac

     2881 gactcactat agggcgaatt ggagctcgga tccctataca gttgaagtcg gaagtttaca

     2941 tacacttaag ttggagtcat taaaactcgt ttttcaacta ctccacaaat ttcttgttaa

     3001 caaacaatag ttttggcaag tcagttagga catctacttt gtgcatgaca caagtcattt

     3061 ttccaacaat tgtttacaga cagattattt cacttataat tcactgtatc acaattccag

     3121 tgggtcagaa gtttacatac actaagttga ctgtgccttt aaacagcttg gaaaattcca

     3181 gaaaatgatg tcatggcttt agaagctcta gtcgtgctag ctggacgcac tcgaggattt

     3241 aacaaaaatt taacgcgaat tttaacaaaa tattaacgct tacaatttac gcgttaagat

     3301 acattgatga gtttggacaa accacaacta gaatgcagtg aaaaaaatgc tttatttgtg

     3361 aaatttgtga tgctattgct ttatttgtaa ccattataag ctgcaataaa caagttaaca

     3421 acggccgctc acttgtacag ctcgtccatg cccagggtga tgccggcggc ggtcacgaac

     3481 tccagcagca ccatgtggtc cctcttctcg ttagggtcct tgctcagggc gctctggtag

     3541 ctcaggtagt ggttgtcggg cagcagcacg gggccgtcgc cgatgggggt gttctgctgg

     3601 tagtggtcgg ccagctgcac gccgccgtcc tcgatgttgt gcctgatctt gaagttggcc

     3661 ttgatgccgt tcttctgctt gtcggcggtg atgtacacgt tgtggctgtt gtagttgtac

     3721 tccagcttgt ggcccaggat gttgccgtcc tccttgaagt cgatgccctt cagctcgatt

     3781 ctgttcacca gggtgtcgcc ctcgaacttc acctcggctc tggtcttgta gttgccgtcg

     3841 tccttgaaga agatggttct ctcctgcacg tagccctcag gcatggcgga cttgaagaag

     3901 tcgtgctgct tcatgtggtc ggggtatctg gcgaagcact gcaggccgta gcccagggtg

     3961 gtcaccaggg taggccaggg cacaggcagc ttgccggtgg tgcagatcag cttcagggtc

     4021 agcttgccgt aggtggcgtc gccctcgccc tcgccgctca cggagaactt gtggccgttc

     4081 acgtcgccgt ccagctccac caggatgggc accacgccgg tgaacagctc ctcgcccttg

     4141 gacaccatgg tctagattaa ttaaggatct gtaggaaaaa gaagaaggca tgaacatggt

     4201 tagcagaggc tctagagccg ccggtcacac gccagaagcc gaaccccgcc ctgccccgtc

     4261 ccccccgaag gcagccgtcc ccctgcggca gccccgaggc tggagatgga gaaggggacg

     4321 gcggcgcggc gacgcacgaa ggccctcccc gcccatttcc ttcctgccgg cgccgcaccg

     4381 cttcgcccgc gcccgctaga gggggtgcgg cggcgcctcc cagatttcgg ctccgccaga

     4441 tttgggacaa aggaagtccc tgcgccctct cgcacgatta ccataaaagg caatggctgc

     4501 ggctcgccgc gcctcgacag ccgccggcgc tccggggccg ccgcgcccct cccccgagcc

     4561 ctccccggcc cgaggcggcc ccgccccgcc cggcaccccc acctgccgcc accccccgcc

     4621 cggcacggcg agccccgcgc cacgccccgc acggagcccc gcacccgaag ccgggccgtg

     4681 ctcagcaact cggggagggg ggtgcagggg ggggttacag cccgaccgcc gcgcccacac

     4741 cccctgctca cccccccacg cacacacccc gcacgcagcc tttgttcccc tcgcagcccc

     4801 cccgcaccgc ggggcaccgc ccccggccgc gctcccctcg cgcacacgcg gagcgcacaa

     4861 agccccgcgc cgcgcccgca gcgctcacag ccgccgggca gcgcgggccg cacgcggcgc

     4921 tccccacgca cacacacacg cacgcacccc ccgagccgct cccccccgca caaagggccc

     4981 tcccggagcc ctttaaggct ttcacgcagc cacagaaaag aaacgagccg tcattaaacc

     5041 aagcgctaat tacagcccgg aggagaaggg ccgtcccgcc cgctcacctg tgggagtaac

     5101 gcggtcagtc agagccgggg cgggcggcgc gaggcggcgc ggagcggggc acggggcgaa

     5161 ggcaacgcag cgactcccgc ccgccgcgcg cttcgctttt tatagggccg ccgccgccgc

     5221 cgcctcgcca taaaaggaaa ctttcggagc gcgccgctct gattggctgc cgccgcacct

     5281 ctccgcctcg ccccgccccg cccctcgccc cgccccgccc cgcctggcgc gcgccccccc

     5341 cccccccgcc cccatcgctg cacaaaataa ttaaaaaata aataaataca aaattggggg

     5401 tggggagggg ggggagatgg ggagagtgaa gcagaacgtg gggctcacct cgacccatgg

     5461 taatagcgat gactaatacg tagatgtact gccaagtagg aaagtcccat aaggtcatgt

     5521 actgggcata atgccaggcg ggccatttac cgtcattgac gtcaataggg ggcgtacttg

     5581 gcatatgata cacttgatgt actgccaagt gggcagttta ccgtaaatag tccacccatt

     5641 gacgtcaatg gaaagtccct attggcgtta ctatgggaac atacgtcatt attgacgtca

     5701 atgggcgggg gtcgttgggc ggtcagccag gcgggccatt taccgtaagt tatgtaacgc

     5761 ggaactccat atatgggcta tgaactaatg accccgtaat tgattactat taataactag

     5821 agcttgtgga aggctactcg aaatgtttga cccaagttaa acaatttaaa ggcaatgcta

     5881 ccaaatacta attgagtgta tgtaaacttc tgacccactg ggaatgtgat gaaagaaata

     5941 aaagctgaaa tgaatcattc tctctactat tattctgata tttcacattc ttaaaataaa

     6001 gtggtgatcc taactgacct aagacaggga atttttacta ggattaaatg tcaggaattg

     6061 tgaaaaagtg agtttaaatg tatttggcta aggtgtatgt aaacttccga cttcaactgt

     6121 ata

//

 

Caution:
1.  This product is FOR RESEARCH USE ONLY!
2.  The item is lyophilized form, Please take the powder plasmid by centrifugation at 5000rpm/min for 1min. Add 20μl ddH2O in to the tube of plasmid.

 

Search name

pT2/VENUS,Plasmid pT2/VENUS,pT2/VENUS vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart